Web Catalogs ⋅ All U.S. FedForms ⋅ Convert PDF to Fillable Savable ⋅ Privacy Policy

Catalog of Public.Navy.Mil
Page 9 of 11
(Records 80,001...90,000)







1. Path: SURFOR: DDG85: PAGES
2. File: USSFITZGERALD,USSMCCAMPBELLBEGINEXERCISEWITHRUSSIANNAVY
3. Title: USS FITZGERALD, USS MCCAMPBELL BEGIN EXERCISE WITH RUSSIAN NAVY
4. Description: THE FORWARD DEPLOYED ARLEIGH BURKE-CLASS GUIDED MISSILE DESTROYER USS MCCAMPBELL (DDG 85), LEADS THE WAY DURING PACIFIC EAGLE, A BILATERAL EXERCISE WITH RUSSIAN FEDERATION NAVY VESSELS, SLAVA CLASS GUIDED MISSILE CRUISER VARYAG AND THE IRKUT TANKER, AND U.S. ARLEIGH BURKE-CLASS GUIDED MISSILE DESTROYER USS FITZGERALD (DDG 62).
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSFITZGERALD,USSMCCAMPBELLBEGINEXERCISEWITHRUSSIANNAVY
3. Title: USS MCCAMPBELL LEADS THE WAY DURING PACIFIC EAGLE, A BILATERAL EXERCISE WITH RUSSIAN FEDERATION NAVY VESSELS.
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLARRIVESININDIA
3. Title: USS MCCAMPBELL ARRIVES IN INDIA
4. Description: CHENNAI, INDIA - THE GUIDED-MISSILE DESTROYER USS MCCAMPBELL (DDG 85) ARRIVED IN INDIA FOR A PORT VISIT.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLARRIVESININDIA
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLARRIVESINISHINOMAKIFORCOMMEMORATIVEPORTVISIT
3. Title: USS MCCAMPBELL ARRIVES IN ISHINOMAKI FOR COMMEMORATIVE PORT VISIT
4. Description: ISHINOMAKI, JAPAN – USS MCCAMPBELL (DDG 85) AND JS TAKANAMI (DD 110) ARRIVED IN ISHINOMAKI MARCH 10 TO PAY HOMAGE AND REMEMBER THOSE WHO LOST THEIR LIVES AND THE MANY MORE WHO WERE DISPLACED DURING THE GREAT EAST JAPAN EARTHQUAKE AND TSUNAMI.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLARRIVESINISHINOMAKIFORCOMMEMORATIVEPORTVISIT
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLARRIVESINSAIPAN
3. Title: USS MCCAMPBELL ARRIVES IN SAIPAN
4. Description: SAIPAN – THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MCCAMPBELL (DDG 85) ARRIVED IN SAIPAN FOR A PORT VISIT WHILE ON PATROL IN THE 7TH FLEET AREA OF RESPONSIBILITY (AOR).
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLARRIVESINSAIPAN
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLARRIVESINSINGAPORE
3. Title: A PORT OPERATIONS TUG BOAT AT FLEET ACTIVITIES YOKOSUKA ASSISTS USS MCCAMPBELL (DDG 85) GET UNDERWAY.
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLARRIVESINSINGAPORE
3. Title: USS MCCAMPBELL ARRIVES IN SINGAPORE
4. Description: SINGAPORE (MAY 16, 2011) - ARLEIGH BURKE-CLASS, GUIDED-MISSILE DESTROYER USS MCCAMPBELL (DDG 85) ARRIVED IN SINGAPORE FOR A PORT VISIT MAY 16.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLCOMPLETESEXERCISEWITHREPUBLICOFKOREANAVY
3. Title: USS MCCAMPBELL COMPLETES EXERCISE WITH REPUBLIC OF KOREA NAVY
4. Description: PACIFIC OCEAN – THE GUIDED-MISSILE DESTROYER USS MCCAMPBELL (DDG 85) COMPLETED A PASSING EXERCISE WITH THE REPUBLIC OF KOREA ULSAN-CLASS FRIGATE ROKS SEOUL (FF 952) ON APRIL 18.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLCOMPLETESEXERCISEWITHREPUBLICOFKOREANAVY
3. Title: USS MCCAMPBELL SAILS ALONGSIDE THE REPUBLIC OF KOREA ULSAN-CLASS FRIGATE ROKS SEOUL FF 952
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLCOMPLETESREPLENISHMENTATSEA
3. Title: SAILORS ASSIGNED TO USS MCCAMPBELL (DDG 85) HEAVE LINE DURING A REPLENISHMENT AT SEA.
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLCOMPLETESREPLENISHMENTATSEA
3. Title: USS MCCAMPBELL COMPLETES REPLENISHMENT AT SEA
4. Description: EAST CHINA SEA – SAILORS ASSIGNED TO ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MCCAMPBELL (DDG 85) COMPLETED A REPLENISHMENT AT SEA (RAS) WITH HENRY J. KAISER-CLASS FLEET REPLENISHMENT OILER USNS WALTER S. DIEHL (T-AO 193) ON MAY 26.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLCONDUCTSANTI SUBMARINEWARFAREEXERCISE
3. Title: USS MCCAMPBELL CONDUCTS ANTI-SUBMARINE WARFARE EXERCISE
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLCONDUCTSANTI SUBMARINEWARFAREEXERCISE
3. Title: USS MCCAMPBELL CONDUCTS ANTI-SUBMARINE WARFARE EXERCISE
4. Description: PHILIPPINE SEA - OPERATIONS SPECIALIST SEAMAN PETER TASSANI TRACKS SURFACE CONTACTS ON THE SPA-25G RADIO DETECTION AND RANGING (RADAR) DISPLAY IN THE COMBAT INFORMATION CENTER ABOARD THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MCCAMPBELL (DDG 85) DURING AN ANTI-SUBMARINE WARFARE EXERCISE.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLCONDUCTSAREPLENISHMENT AT SEA
3. Title: USS MCCAMPBELL CONDUCTS RAS
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLCONDUCTSAREPLENISHMENT AT SEA
3. Title: USS MCCAMPBELL CONDUCTS A REPLENISHMENT-AT-SEA
4. Description: WATERS TO THE WEST OF THE KOREAN PENINSULA - THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MCCAMPBELL (DDG 85), RIGHT, CONDUCTS A REPLENISHMENT-AT-SEA WITH THE REPUBLIC OF KOREA NAVY CHEONJI-CLASS FAST COMBAT SUPPORT SHIP ROKS CHEONJI (AOE 57) DURING EXERCISE FOAL EAGLE 2013.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLCREWSETSSTANDARDFORGIVING
3. Title: AN AERIAL VIEW OF DAMAGE TO NORTH HONSHU, JAPAN AFTER A 9.0 MAGNITUDE EARTHQUAKE
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLCREWSETSSTANDARDFORGIVING
3. Title: USS MCCAMPBELL CREW SETS STANDARD FOR GIVING
4. Description: NORTH HONSHU, JAPAN (MARCH 18, 2011) - AN AERIAL VIEW OF DAMAGE TO NORTH HONSHU, JAPAN AFTER A 9.0 MAGNITUDE EARTHQUAKE AND SUBSEQUENT TSUNAMI DEVASTATED THE AREA IN NORTHERN JAPAN.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLDEPARTSSINGAPORE
3. Title: USS MCCAMPBELL (DDG 85) DEPARTS CHANGI NAVAL BASE FOLLOWING A FIVE-DAY PORT VISIT IN SINGAPORE
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLDEPARTSSINGAPORE
3. Title: USS MCCAMPBELL DEPARTS SINGAPORE
4. Description: SINGAPORE (MAY 21, 2011) – THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MCCAMPBELL (DDG 85) DEPARTS CHANGI NAVAL BASE FOLLOWING A FIVE-DAY PORT VISIT IN SINGAPORE. USS MCCAMPBELL IS ASSIGNED TO DESTROYER SQUADRON 15 AND IS CURRENTLY UNDERWAY AS PART OF HER SPRING PATROL.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLHOLDSMEMORIALCEREMONYFORTHEBATTLEOFLEYTEGULF
3. Title: ENGINEMAN 1ST CLASS WILLIAM EMBRY GIVES A SPEECH ABOARD USS MCCAMPBELL (DDG 85)
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLHOLDSMEMORIALCEREMONYFORTHEBATTLEOFLEYTEGULF
3. Title: USS MCCAMPBELL HOLDS MEMORIAL CEREMONY FOR THE BATTLE OF LEYTE GULF
4. Description: PACIFIC OCEAN - A CEREMONY TO HONOR THOSE WHO FOUGHT IN THE BATTLE OF LEYTE GULF WAS HELD ON THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MCCAMPBELL (DDG 85).
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLINTERACTSDURINGIMDEX
3. Title: MEMBERS OF THE USS MCCAMPBELL (DDG 85) VBSS TEAM CONDUCT A POST MISSION BRIEF
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLINTERACTSDURINGIMDEX
3. Title: USS MCCAMPBELL INTERACTS DURING IMDEX
4. Description: SINGAPORE (MAY 19, 2011) - MEMBERS OF THE USS MCCAMPBELL (DDG 85) VISIT, BOARD, SEARCH AND SEIZURE (VBSS) TEAM CONDUCT A POST MISSION BRIEF WITH MEMBERS OF THE REPUBLIC OF SINGAPORE NAVY AND ROYAL NEW ZEALAND NAVY, FOLLOWING A VBSS TRAINING EVOLUTION.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLJSTAKANAMIDEMONSTRATEINTEROPERABILITYDURINGGOODWILLEXERCISE
3. Title: USS MCCAMPBELL, JS TAKANAMI DEMONSTRATE INTEROPERABILITY DURING GOODWILL EXERCISE
4. Description: OFF THE SOUTHERN COAST OF JAPAN – THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MCCAMPBELL (DDG 85) PARTICIPATED IN A GOODWILL EXERCISE WITH JAPAN MARITIME SELF-DEFENCE FORCE (JMSDF) DESTROYER TAKANAMI (DD 110).
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLJSTAKANAMIDEMONSTRATEINTEROPERABILITYDURINGGOODWILLEXERCISE
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLPROVIDESAIDTOHOSTNATION
3. Title: JAPAN GROUND-SELF DEFENSE FORCE VEHICLES
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLPROVIDESAIDTOHOSTNATION
3. Title: USS MCCAMPBELL PROVIDES AID TO HOST NATION
4. Description: PACIFIC OCEAN (MAR. 16, 2011) - USS MCCAMPBELL (DDG 85) WAS AMONG THE FIRST U.S. NAVY SHIPS TO MOVE INTO POSITION AND OFFER ASSISTANCE TO JAPANESE CITIZENS MARCH 11, AFTER THE NATION WAS STRUCK BY AN EARTHQUAKE AND TSUNAMI.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLREPLENISHESTOCONTINUERELIEFTOJAPAN
3. Title: USS MCCAMPBELL (DDG 85) CREW MEMBERS WORK TO BRING ON HUMANITARIAN ASSISTANCE AND DISASTER RELIEF SUPPLIES
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLREPLENISHESTOCONTINUERELIEFTOJAPAN
3. Title: USS MCCAMPBELL REPLENISHES TO CONTINUE RELIEF TO JAPAN
4. Description: PACIFIC OCEAN (MARCH 23, 2011) – USS MCCAMPBELL (DDG 85) CREW MEMBERS WORK TO BRING ON HUMANITARIAN ASSISTANCE AND DISASTER RELIEF SUPPLIES DURING AN UNDERWAY REPLENISHMENT.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLRESCUESSTRANDEDFISHERMEN
3. Title: USS MCCAMPBELL RESCUES STRANDED FISHERMEN
4. Description: SOUTH CHINA SEA - FISHERMAN FROM THE REPUBLIC OF THE PHILIPPINES REST AND RECEIVE MEDICAL EVALUATIONS ABOARD THE GUIDED-MISSILE DESTROYER USS MCCAMPBELL (DDG 85) AFTER BEING RESCUED FROM THEIR VESSEL.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLRESCUESSTRANDEDFISHERMEN
3. Title: USS MCCAMPBELL RESCUES STRANDED FISHERMEN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLRETURNSTOSEA
3. Title: USS MCCAMPBELL (DDG85)
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLRETURNSTOSEA
3. Title: USS MCCAMPBELL RETURNS TO SEA
4. Description: YOKOSUKA, JAPAN – ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MCCAMPBELL (DDG 85), FORWARD DEPLOYED TO COMMANDER FLEET ACTIVITIES YOKOSUKA, THE SHIP WILL COMPLETE A THREE AND A HALF-MONTH DRY DOCK PERIOD FEB. 29, TO COMMENCE SEA TRIALS.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLSAILORNAVIGATESPHILIPPINESEA
3. Title: USS MCCAMPBELL SAILOR NAVIGATES PHILIPPINE SEA
4. Description: PHILIPPINE SEA - ENSIGN MATTHEW HEIN, ASSIGNED TO USS MCCAMPBELL (DDG 85), TAKES A BEARING ON THE BRIDGE WING.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLSAILORNAVIGATESPHILIPPINESEA
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLSAILORSVISITCHILDRENSHOSPITALATWESTMEAD
3. Title: USS MCCAMPBELL SAILORS VISIT CHILDRENS HOSPITAL AT WESTMEAD
4. Description: SAILORS ASSIGNED TO THE ARLEIGH BURKE CLASS DESTROYER USS MCCAMPBELL (DDG 85) JOINED SAILORS FROM HER MAJESTY’S AUSTRALIAN SHIP PARRAMATTA FOR A SERVICE PROJECT AT THE CHILDREN’S HOSPITAL AT WESTMEAD DURING MCCAMPBELL’S PORT VISIT TO SYDNEY.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLSAILORSVISITCHILDRENSHOSPITALATWESTMEAD
3. Title: USS MCCAMPBELL SAILORS VISIT CHILDRENS HOSPITAL AT WESTMEAD
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLSTRENGTHENSPARTNERSHIP
3. Title: USS MCCAMPBELL STRENGTHENS PARTNERSHIP
4. Description: PACIFIC OCEAN (APRIL 18, 2011) THE GUIDED-MISSILE DESTROYER USS MCCAMPBELL (DDG 85), RIGHT, IS UNDERWAY ALONGSIDE THE REPUBLIC OF KOREA ULSAN-CLASS FRIGATE ROKS SEOUL (FF 952) DURING A PASSING EXERCISE.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLSTRENGTHENSPARTNERSHIP
3. Title: USS MCCAMPBELL IS UNDERWAY ALONGSIDE THE REPUBLIC OF KOREA ULSAN-CLASS FRIGATE ROKS SEOUL (FF 952) DURING A PASSING EXERCISE
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLHONORSWWIIVETERAN
3. Title: USS MCCAMPBELL HONORS WWII VETERAN
4. Description: WHITE BEACH OKINAWA, JAPAN– SAILORS ABOARD THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MCCAMPBELL (DDG 85) HONORED WORLD WAR II VETERAN WAYNE HEYART WITH A CEREMONY ON THE SHIP’S FORECASTLE DURING A JUNE 1 PORT VISIT TO WHITE BEACH, OKINAWA.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLHONORSWWIIVETERAN
3. Title: WAYNE HEYART, A FORMER RADIOMAN 1ST CLASS AND WORLD WAR II VETERAN, SPEAKS ABOUT HIS EXPERIENCES IN THE NAVY.
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLPARTICIPATESINEXERCISEKEENSWORD2013
3. Title: USS MCCAMPBELL PARTICIPATES IN EXERCISE KEEN SWORD 2013
4. Description: PHILIPPINE SEA - SENIOR CHIEF JIN HIROYUKI, A MEMBER OF THE JAPAN MARITIME SELF DEFENSE FORCE, SPEAKS WITH GUNNER'S MATE 3RD CLASS DARONTE HIGH ABOARD THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MCCAMPBELL (DDG 85), DURING EXERCISE KEEN SWORD 2013.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLPARTICIPATESINEXERCISEKEENSWORD2013
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLPARTICIPATESINEXERCISEPACIFICBOND2012
3. Title: CHIEF PERSONNEL SPECIALIST SALUTES JAPANS MARITIME SELF DEFENSE FORCE HATAKAZE-CLASS DESTROYER AS IT MANEUVERS INTO FORMATION
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLPARTICIPATESINEXERCISEPACIFICBOND2012
3. Title: USS MCCAMPBELL PARTICIPATES IN EXERCISE PACIFIC BOND 2012
4. Description: EAST CHINA SEA – THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MCCAMPBELL (DDG 85) JOINED THE JAPAN MARITIME SELF DEFENSE FORCE HATAKAZE-CLASS DESTROYER JS SHIMAKAZE (DDG 172) AND ROYAL AUSTRALIAN NAVY ANZAC-CLASS FRIGATE HMAS BALLARAT (FFH 155) TO PARTICIPATE IN THE MILITARY EXERCISE PACIFIC BOND 2012.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLSMEDICALDEPARTMENTTRAINSFIRSTRESPONDERS
3. Title: USS MCCAMPBELLS MEDICAL DEPARTMENT TRAINS FIRST RESPONDERS
4. Description: EAST CHINA SEA – HOSPITAL CORPSMEN THROUGHOUT THE NAVY HAVE THE ULTIMATE RESPONSIBILITY TO RENDER MEDICAL ASSISTANCE AT A MOMENT’S NOTICE AND THE CORPSMEN ASSIGNED TO THE MEDICAL DEPARTMENT ABOARD THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MCCAMPBELL (DDG 85) LIVE UP TO THAT RESPONSIBILITY EVERY DAY.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLSMEDICALDEPARTMENTTRAINSFIRSTRESPONDERS
3. Title: USS MCCAMPBELLS MEDICAL DEPARTMENT TRAINS FIRST RESPONDERS
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLVISITSTHEREPUBLICOFTHEPHILIPPINES
3. Title: USS MCCAMPBELL VISITS THE REPUBLIC OF THE PHILIPPINES
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USSMCCAMPBELLVISITSTHEREPUBLICOFTHEPHILIPPINES
3. Title: USS MCCAMPBELL VISITS THE REPUBLIC OF THE PHILIPPINES
4. Description: MANILA, REPUBLIC OF THE PHILIPPINES - ENSIGN JOSE GANDIA, ASSIGNED TO THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MCCAMPBELL (DDG 85), SALUTES MEMBERS OF THE REPUBLIC OF PHILIPPINES NAVY AS THEY BOARD THE SHIP FOR A TOUR.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: DEFAULT
3. Title: USS MCCAMPBELL (DDG 85)
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: DEFAULT
3. Title: USS MCCAMPBELL (DDG 85)
4. No description
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USS MCCAMPBELL CHANGES COMMAND
3. Title: USS MCCAMPBELL CHANGES COMMAND
4. Description: YOKOSUKA, JAPAN – CMDR. EDWARD SUNDBERG, COMMANDING OFFICER OF THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MCCAMPBELL (DDG 85), RENDERS A SALUTE WHILE PASSING THROUGH SIDE BOYS DURING A CHANGE OF COMMAND CEREMONY ABOARD THE SHIP.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG85: PAGES
2. File: USS MCCAMPBELL CHANGES COMMAND
3. Title: USS MCCAMPBELL CHANGES COMMAND
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: PHOTOS
2. File: 100413 N MCCAMPBELL BQM74E TGT DRONES
3. Title: BQM-74E TARGET DRONES ARE LAUNCHED FROM THE GUIDED-MISSILE DESTROYER USS MCCAMPBELL (DDG 85).
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: 100707 N 3215T MCC UNDERWAY
3. Title: THE USS MCCAMPBELL (DDG 85) GETS UNDERWAY
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: 110316 N 2348B 013
3. Title: JAPAN GROUND-SELF DEFENSE FORCE VEHICLES
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: 110318 N 0076O 004
3. Title: AN AERIAL VIEW OF DAMAGE TO NORTH HONSHU, JAPAN AFTER A 9.0 MAGNITUDE EARTHQUAKE
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: 110323 N XXXXX 001
3. Title: USS MCCAMPBELL (DDG 85) CREW MEMBERS WORK TO BRING ON HUMANITARIAN ASSISTANCE AND DISASTER RELIEF SUPPLIES
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: 110521 N SF508 057
3. Title: USS MCCAMPBELL (DDG 85) DEPARTS CHANGI NAVAL BASE FOLLOWING A FIVE-DAY PORT VISIT IN SINGAPORE
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: 110804 N EA192 009
3. Title: ENGINEMAN 1ST CLASS WILLIAM EMBRY GIVES A SPEECH ABOARD USS MCCAMPBELL (DDG 85)
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: 111013 N UE250 184
3. Title: USS MCCAMPBELL LEADS THE WAY DURING PACIFIC EAGLE, A BILATERAL EXERCISE WITH RUSSIAN FEDERATION NAVY VESSELS.
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: 120526 N TG831 177
3. Title: SAILORS ASSIGNED TO USS MCCAMPBELL (DDG 85) HEAVE LINE DURING A REPLENISHMENT AT SEA.
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: 120526 N TG831 622
3. Title: SAILORS ASSIGNED TO USS MCCAMPBELL PREPARE TO RECEIVE MISSION ESSENTIAL GOODS DURING A REPLENISHMENT AT SEA.
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: 120601 N TG831 125
3. Title: WAYNE HEYART, A FORMER RADIOMAN 1ST CLASS AND WORLD WAR II VETERAN, SPEAKS ABOUT HIS EXPERIENCES IN THE NAVY.
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: 120606 N TG831 206
3. Title: CHIEF PERSONNEL SPECIALIST SALUTES JAPANS MARITIME SELF DEFENSE FORCE HATAKAZE-CLASS DESTROYER AS IT MANEUVERS INTO FORMATION
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: 120829 N TG831 169
3. Title: MCCAMPBELL SAILORS CONDUCT SMALL BOAT TRAINING
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: 120910 N TG831 324
3. Title: GUNNERS MATE SEAMAN DWAYNE JOSEPH, ASSIGNED TO USS MCCAMPBELL HEAVES LINE DURING A REPLENISHMENT-AT-SEA.
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: 120917 N TG831 042
3. No title
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: 121019 N TG831 116
3. Title: USS MCCAMPBELL (DDG 85) FIRES ITS MK45 5-INCH LIGHTWEIGHT GUN DURING A LIVE-FIRE EXERCISE.
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: 5738709893 0FFB818047 Z
3. Title: MEMBERS OF THE USS MCCAMPBELL (DDG 85) VBSS TEAM CONDUCT A POST MISSION BRIEF
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: DDG85 REPLENISHMENT
3. Title: USS MCCAMPBELL DDG 85 REPLENISHMENT
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: COAT OF ARMS DDG85
3. No title
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: DDG85 BANNER
3. No title
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: RE UP GM2
3. Title: GUNNERS MATE 2ND CLASS WATIE ALBERTY RE-ENLISTS ON THE TALLEST MOUNTAIN IN JAPAN, MT. FUJI
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: WEB 100707 N 3215T 028
3. Title: A PORT OPERATIONS TUG BOAT AT FLEET ACTIVITIES YOKOSUKA ASSISTS USS MCCAMPBELL (DDG 85) GET UNDERWAY.
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PHOTOS
2. File: WEB 110418 N 0749A 001
3. Title: USS MCCAMPBELL IS UNDERWAY ALONGSIDE THE REPUBLIC OF KOREA ULSAN-CLASS FRIGATE ROKS SEOUL (FF 952) DURING A PASSING EXERCISE
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: 160921 N NT265 002
3. Title: DDG85
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: 170203 N HI376 020
3. Title: DDG85
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: 171006 N XK398 052
3. No title
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: 6073390961 5F298A9016 O
3. Title: USS MCCAMPBELL
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: CMC RUCKER SMALL
3. Title: CMDCM(SW/AW) LOREN D. RUCKER
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: CMC RUCKER
3. Title: CMDCM(SW/AW) LOREN D. RUCKER
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: CMC TOKARSKI SMALL
3. Title: COMMAND MASTER CHIEF (AUGUST 2015 - PRESENT)
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: CMC TOKARSKI
3. Title: COMMAND MASTER CHIEF (AUGUST 2015 - PRESENT)
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: CMDCM MAGNETTA
3. Title: CMDCM (SW/AW) MICHAEL J. MAGNETTA
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: CO CDR ALLISON SMALL
3. Title: OCTOBER 7, 2017 - PRESENT
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: CO CDR ALLISON
3. Title: OCTOBER 7, 2017 - PRESENT
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: CO CALFEE SMALL
3. Title: CDR SHARIF H. CALFEE
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: CO SULLIVAN SMALL
3. Title: (MAY 4, 2019 - PRESENT)
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: CO SULLIVAN
3. Title: (MAY 4, 2019 - PRESENT)
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: CORNISH STG1 5X7
3. Title: STGL(SW /IUSS) RICHARD J. CORNISH
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: DDG85 DAVID MCCAMPBELL
3. Title: DAVID MCCAMPBELL
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: DDG85 CMC
3. Title: CMDCM (SW/AW) CARL L. DUNCAN
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: DDG85 CO
3. Title: CDR THOMAS "TJ"DIXON
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: LCDR BLAND SMALL
3. Title: (AUGUST 20, 2019 - PRESENT)
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: LCDR BLAND
3. Title: (AUGUST 20, 2019 - PRESENT)
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: LCDRORENDERUNCOVERED
3. Title: LCDR JASON ORENDER
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: MCCAMPBELL CO
3. Title: CDR STEVEN H. DEMOSS
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: XO ALLISON SMALL
3. Title: MAY 4, 2014 - PRESENT
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: XO ALLISON
3. Title: MAY 4, 2014 - PRESENT
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: XO ANGELINAS SMALL
3. Title: EXECUTIVE OFFICER (NOVEMBER 25, 2014 - PRESENT)
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: XO CDR SULLIVAN PATRICK (COVERED)
3. Title: JULY 29, 2017 - PRESENT
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: XO CDR SULLIVAN PATRICK SMALL
3. Title: JULY 29, 2017 - PRESENT
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: XO CALFEE COVERED2 SMALL
3. Title: CDR SHARIF H. CALFEE
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: XO SUNDBERG SMALL
3. Title: CDR EDWARD D. SUNDBERG
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: ZIELECHOWSKI BIG
3. No title
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: ZIELECHOWSKI SMALL
3. No title
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: CDRSUNDBERG
3. Title: COMMANDING OFFICER (DECEMBER 19, 2014 - PRESENT)
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: CMC HOWELL SMALL
3. Title: JUNE 19, 2018 - PRESENT
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: CMC HOWELL
3. Title: JUNE 19, 2018 - PRESENT
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: CMC JONES SMALL
3. Title: MARCH 21, 2018 - PRESENT
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: CO CDR ANGELINAS SMALL
3. Title: (MAY 4, 2016 - PRESENT
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: CO CDR ANGELINAS
3. Title: (MAY 4, 2016 - PRESENT
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: DDG85 CO THUMBNAIL
3. Title: CDR THOMAS "TJ"DIXON
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: LCDR CLEMONS SMALL
3. Title: (FEBRUARY 2019 - PRESENT)
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: PUBLISHINGIMAGES
2. File: LCDR CLEMONS
3. Title: (FEBRUARY 2019 - PRESENT)
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: IMAGES
2. File: SPONSOR
3. No title
4. No description
5. No keywords
6. Extension: JPG


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: AMERICAN, BRITISH NAVIES SAIL TOGETHER IN SOUTH CHINA SEA
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: AMERICAN, BRITISH NAVIES SAIL TOGETHER IN SOUTH CHINA SEA
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: AMMUNITIONONLOADABOARDUSSMCCAMPBELL
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: AMMUNITIONONLOADABOARDUSSMCCAMPBELL
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BQM 74E TGT DRONES
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BQM 74E TGT DRONES
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO1 19DECEMBER2014 3MAY2016
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO1 19DECEMBER2014 3MAY2016
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO1 4MAY2016 6OCTOBER2016
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO1 4MAY2016 6OCTOBER2016
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO1 6OCTOBER3027 3MAY2019
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO1 6OCTOBER3027 3MAY2019
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO1 APR2012 JULY2013
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO1 APR2012 JULY2013
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO1 APRIL2012 RELIEVED
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO1 APRIL2012 RELIEVED
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO1JULY2013 DEC2014
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO1JULY2013 DEC2014
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO1
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO1
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO2 01JUL2013 24NOV2014
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO2 01JUL2013 24NOV2014
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO2 20AUGUST2019 18MAY2020
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO2 20AUGUST2019 18MAY2020
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO2 25NOVEMBER2014 3MAY2016
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO2 25NOVEMBER2014 3MAY2016
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO2 29SEPTEMBER2017 4FEBRUARY2019
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO2 29SEPTEMBER2017 4FEBRUARY2019
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO2 4MAY2014 28JULY2017
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO2 4MAY2014 28JULY2017
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO2 5FEBRUARY2019 19AUGUST2019
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO2 5FEBRUARY2019 19AUGUST2019
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO2 JAN2012 JULY2013
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO2 JAN2012 JULY2013
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO2 RELIEVEDJAN2012 XOORENDER
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO2 RELIEVEDJAN2012 XOORENDER
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO2
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO2
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO3 15AUGUST2015 12JUNE2018
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO3 15AUGUST2015 12JUNE2018
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO3 15AUGUST2015 20MARCH2018
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO3 15AUGUST2015 20MARCH2018
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO3 24APRIL2014 AUGUST2015
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO3 24APRIL2014 AUGUST2015
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO3 APR09 MAY11
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO3 APR09 MAY11
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO3 MAY2011 APR2013
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO3 MAY2011 APR2013
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO3
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: BIO3
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: CNO VISITS MCCAMPBELL IN INDIA
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: CNO VISITS MCCAMPBELL IN INDIA
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: CHANGEOFCOMMANDCEREMONYONBOARDUSSMCCAMPBELL
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: CHANGEOFCOMMANDCEREMONYONBOARDUSSMCCAMPBELL
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: COAST GUARD CUTTER AND NAVY DESTROYER TO JOIN EXPEDITIONARY STRIKE GROUP 7
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: COAST GUARD CUTTER AND NAVY DESTROYER TO JOIN EXPEDITIONARY STRIKE GROUP 7
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: FAMILY
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: FAMILY
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: FOODPREPARATIONSONBOARDUSSMCCAMPBELL
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: FOODPREPARATIONSONBOARDUSSMCCAMPBELL
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: HMASSYDNEYARRIVESINJAPANTOINTEGRATEWITHUSNAVY
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: HMASSYDNEYARRIVESINJAPANTOINTEGRATEWITHUSNAVY
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: IKEGOELEMENTARYSCHOOLVISITSUSSMCCAMPBELL
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: IKEGOELEMENTARYSCHOOLVISITSUSSMCCAMPBELL
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: LIVEFIREEXERCISEONBOARDUSSMCCAMPBELL
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: LIVEFIREEXERCISEONBOARDUSSMCCAMPBELL
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MALABAR2013KICKSOFF
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MALABAR2013KICKSOFF
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELL ARRIVES IN SYDNEY
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELL ARRIVES IN SYDNEY
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELL CONDUCTS BILATERAL SONAR TRAINING
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELL CONDUCTS BILATERAL SONAR TRAINING
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELL EARNS THE BATTLE E FOR 2016
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELL EARNS THE BATTLE E FOR 2016
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELL VISITS OTARU, JAPAN
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELL VISITS OTARU, JAPAN
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELL(DDG85)RETURNSTOCOMMANDERFLEETACTIVITIES,YOKOSUKA
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELL(DDG85)RETURNSTOCOMMANDERFLEETACTIVITIES,YOKOSUKA
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELLCELEBRATESASIANPACIFICCULTUREANDDIVERSITY
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELLCELEBRATESASIANPACIFICCULTUREANDDIVERSITY
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELLCELEBRATESTRADEALLIANCEINANNUALBLACKSHIPFESTIVAL
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELLCELEBRATESTRADEALLIANCEINANNUALBLACKSHIPFESTIVAL
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELLSAILORREENLISTSONMTFUJI
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELLSAILORREENLISTSONMTFUJI
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELLSAILORWINSRARECOPERNICUSAWARD
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELLSAILORWINSRARECOPERNICUSAWARD
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELLSAILORSOPERATE
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELLSAILORSOPERATE
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELLSAILORSRELAXANDUNWINDATSHIPSNEWLIBRARYALOFT
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELLSAILORSRELAXANDUNWINDATSHIPSNEWLIBRARYALOFT
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELLSAILORSSHAREEXPERIENCESLAUGHSWITHSAIPANMIDDLESCHOOL
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELLSAILORSSHAREEXPERIENCESLAUGHSWITHSAIPANMIDDLESCHOOL
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELLSDECKDIVISIONMAINTAINSMISSIONREADINESS
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MCCAMPBELLSDECKDIVISIONMAINTAINSMISSIONREADINESS
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MULTISAILEXER2010
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: MULTISAILEXER2010
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: NAVYCOMPLETESFIRSTCANESINSTALLATIONONUSSMCCAMPBELL
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: NAVYCOMPLETESFIRSTCANESINSTALLATIONONUSSMCCAMPBELL
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: OURSHIP
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: OURSHIP
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: PACIFICFLEETMASTERCHIEFJOHNMINYARDVISITSUSSMCCAMPBELL
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: PACIFICFLEETMASTERCHIEFJOHNMINYARDVISITSUSSMCCAMPBELL
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: PASTLEADERSHIP
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: PASTLEADERSHIP
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: PHOTOGALLERY
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: PHOTOGALLERY
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: REPLENISHMENTATSEAONUSSMCCAMPBELL
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: REPLENISHMENTATSEAONUSSMCCAMPBELL
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: REPLENISHMENTATSEAONBOARDUSSMCCAMPBELL
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: REPLENISHMENTATSEAONBOARDUSSMCCAMPBELL
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: SSO PACIFIC
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: SSO PACIFIC
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: STG1 RICHARD CORNISH
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: STG1 RICHARD CORNISH
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: STRONGER TOGETHER
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: STRONGER TOGETHER
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: THEGUIDED MISSILEDESTROYERUSSMCCAMPBELL(DDG85)APPROACHESTHEMILITARYSEALIFTCOMMANDFLEETREPLENISHMENTOILERUSNSPECOS(T AO 197)
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: THEGUIDED MISSILEDESTROYERUSSMCCAMPBELL(DDG85)APPROACHESTHEMILITARYSEALIFTCOMMANDFLEETREPLENISHMENTOILERUSNSPECOS(T AO 197)
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USN ROKN JMSDF CONDUCT ANTI SUBMARINE WARFARE EXERCISE
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USN ROKN JMSDF CONDUCT ANTI SUBMARINE WARFARE EXERCISE
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USS MCCAMPBELL CONDUCTS ALL FEMALE NAVIGATION EVOLUTION
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USS MCCAMPBELL CONDUCTS ALL FEMALE NAVIGATION EVOLUTION
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USS MCCAMPBELL ENHANCES TACTICAL READINESS
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USS MCCAMPBELL ENHANCES TACTICAL READINESS
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USS MCCAMPBELL HOLDS CHANGE OF COMMAND
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USS MCCAMPBELL HOLDS CHANGE OF COMMAND
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USS MCCAMPBELL HOLDS CHANGE OF COMMAND
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USS MCCAMPBELL HOLDS CHANGE OF COMMAND
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USS MCCAMPBELL KICKS OFF MALABAR 2019 IN SASEBO
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USS MCCAMPBELL KICKS OFF MALABAR 2019 IN SASEBO
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USS MCCAMPBELL VISITS DONGHAE AFTER EXERCISE
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USS MCCAMPBELL VISITS DONGHAE AFTER EXERCISE
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSFITZGERALD,USSMCCAMPBELLBEGINEXERCISEWITHRUSSIANNAVY
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSFITZGERALD,USSMCCAMPBELLBEGINEXERCISEWITHRUSSIANNAVY
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLARRIVESININDIA
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLARRIVESININDIA
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLARRIVESINISHINOMAKIFORCOMMEMORATIVEPORTVISIT
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLARRIVESINISHINOMAKIFORCOMMEMORATIVEPORTVISIT
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLARRIVESINSAIPAN
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLARRIVESINSAIPAN
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLARRIVESINSINGAPORE
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLARRIVESINSINGAPORE
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLCOMPLETESEXERCISEWITHREPUBLICOFKOREANAVY
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLCOMPLETESEXERCISEWITHREPUBLICOFKOREANAVY
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLCOMPLETESREPLENISHMENTATSEA
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLCOMPLETESREPLENISHMENTATSEA
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLCONDUCTSANTI SUBMARINEWARFAREEXERCISE
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLCONDUCTSANTI SUBMARINEWARFAREEXERCISE
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLCONDUCTSAREPLENISHMENT AT SEA
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLCONDUCTSAREPLENISHMENT AT SEA
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLCREWSETSSTANDARDFORGIVING
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLCREWSETSSTANDARDFORGIVING
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLDEPARTSSINGAPORE
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLDEPARTSSINGAPORE
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLHOLDSMEMORIALCEREMONYFORTHEBATTLEOFLEYTEGULF
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLHOLDSMEMORIALCEREMONYFORTHEBATTLEOFLEYTEGULF
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLINTERACTSDURINGIMDEX
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLINTERACTSDURINGIMDEX
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLJSTAKANAMIDEMONSTRATEINTEROPERABILITYDURINGGOODWILLEXERCISE
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLJSTAKANAMIDEMONSTRATEINTEROPERABILITYDURINGGOODWILLEXERCISE
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLPROVIDESAIDTOHOSTNATION
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLPROVIDESAIDTOHOSTNATION
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLREPLENISHESTOCONTINUERELIEFTOJAPAN
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLREPLENISHESTOCONTINUERELIEFTOJAPAN
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLRESCUESSTRANDEDFISHERMEN
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLRESCUESSTRANDEDFISHERMEN
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLRETURNSTOSEA
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLRETURNSTOSEA
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLSAILORNAVIGATESPHILIPPINESEA
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLSAILORNAVIGATESPHILIPPINESEA
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLSAILORSVISITCHILDRENSHOSPITALATWESTMEAD
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLSAILORSVISITCHILDRENSHOSPITALATWESTMEAD
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLSTRENGTHENSPARTNERSHIP
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLSTRENGTHENSPARTNERSHIP
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLHONORSWWIIVETERAN
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLHONORSWWIIVETERAN
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLPARTICIPATESINEXERCISEKEENSWORD2013
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLPARTICIPATESINEXERCISEKEENSWORD2013
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLPARTICIPATESINEXERCISEPACIFICBOND2012
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLPARTICIPATESINEXERCISEPACIFICBOND2012
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLSMEDICALDEPARTMENTTRAINSFIRSTRESPONDERS
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLSMEDICALDEPARTMENTTRAINSFIRSTRESPONDERS
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLVISITSTHEREPUBLICOFTHEPHILIPPINES
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USSMCCAMPBELLVISITSTHEREPUBLICOFTHEPHILIPPINES
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: DEFAULT
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: DEFAULT
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USS MCCAMPBELL CHANGES COMMAND
3. Title: SIGN IN
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85: LAYOUTS: AUTHENTICATE
2. File: USS MCCAMPBELL CHANGES COMMAND
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG85
2. No filename (redirect)
3. Title: USS MCCAMPBELL
4. No description
5. No keywords
6. No extension (redirect)


1. Path: SURFOR: DDG86: PAGES
2. File: AFLOATCOLLEGEPROGRAMDELIVERSSCHOOL
3. Title: AFLOAT COLLEGE PROGRAM DELIVERS SCHOOLHOUSE TO SHOUP'S SAILORS
4. Description: USS SHOUP, AT SEA (NNS) -- SAILORS ABOARD USS SHOUP (DDG 86) TOOK ADVANTAGE OF FREE COLLEGE COURSES WHILE AT SEA IN JULY AND AUGUST 2010 THROUGH THE NAVY COLLEGE PROGRAM FOR AFLOAT COLLEGE EDUCATION (NCPACE)
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: AFLOATCOLLEGEPROGRAMDELIVERSSCHOOL
3. Title: AFLOAT COLLEGE PROGRAM DELIVERS SCHOOLHOUSE TO SHOUPS SAILORS
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: BATTLEE 2009
3. Title: USS SHOUP EARNS BATTLE E FOR 2009
4. No description
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: BATTLEE 2009
3. Title: USS SHOUP EARNS BATTLE E FOR 2009
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: BIO1 12DEC2012 JUNE2014
3. Title: CDR JILL CESARI
4. No description
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: BIO1 12DEC2012 JUNE2014
3. Title: CDR JILL CESARI
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: BIO1 24NOV2015 16MAR2017
3. Title: CDR JASON EDWARD ROGERS
4. Description: CDR JASON EDWARD ROGERS
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: BIO1 24NOV2015 16MAR2017
3. Title: COMMANDING OFFICER (NOVEMBER 25, 2015 - PRESENT)
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: BIO1
3. Title: CDR SAM HERBST
4. Description: CURRENT COMMANDING OFFICER
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: BIO2 DEC2012 08MAY2014
3. Title: CDR BRYANT P. TROST
4. No description
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: BIO2 DEC2012 08MAY2014
3. Title: CDR BRYANT P. TROST
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: BIO2 RELIEVEDAPR2011
3. Title: CDR MATTHEW P. ROBERTS

4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: BIO2 RELIEVEDAPR2011
3. Title: CDR MATTHEW P. ROBERTS
4. No description
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: BIO3 APR2009 APR2011
3. Title: CMDCM(SW/AW/FMF) CHARLES ANSON BOND
4. No description
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: BIO3 APR2009 APR2011
3. Title: CMDCM(SW/AW/FMF) CHARLES ANSON BOND
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: BIO3 AUG2013 NOV2013
3. Title: BIO3_AUG2013-NOV2013.ASPX

4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: BIO3 AUG2013 NOV2013
3. No title
4. Description: CMC'S BIO PAGE
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: BIO3 JUN2011 AUG2013
3. Title: CMDCM RICK A. HELWICK
4. No description
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: BIO3 JUN2011 AUG2013
3. Title: CMDCM RICK A. HELWICK
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: CJTF HOAOFFICERSVISIT
3. Title: CJTF-HOA OFFICERS VISIT USS SHOUP
4. No description
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: CJTF HOAOFFICERSVISIT
3. Title: CJTF-HOA OFFICERS VISIT USS SHOUP
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: CONGRESSMANVISITSUSSSHOUP
3. Title: CONGRESSMAN VISITS USS SHOUP
4. Description: NAVAL STATION EVERETT, WASH. - CMDR. BRYANT TROST, COMMANDING OFFICER OF THE GUIDED MISSILE DESTROYER USS SHOUP (DDG 86), GIVES A TOUR OF THE SHIP AND A BRIEF ON DESTROYER CAPABILITIES TO U.S. REP. BRADLEY BYRNE (R-ALA.) AT NAVAL STATION EVERETT.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: CONGRESSMANVISITSUSSSHOUP
3. Title: CONGRESSMAN VISITS USS SHOUP
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: FAMILY
3. Title: FAMILY
4. No description
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: FIRESFOREFFECT
3. Title: ON SHORT NOTICE, SHOUP FIRES FOR EFFECT
4. No description
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: FIRESFOREFFECT
3. Title: ON SHORT NOTICE, SHOUP FIRES FOR EFFECT
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: FLIGHTOPERATIONSINHEAVYSEASONUSSSHOUP
3. Title: FLIGHT OPERATIONS IN HEAVY SEAS ON USS SHOUP
4. Description: SOUTH CHINA SEA - LONE WOLF 716 PREPARES FOR FLIGHT IN HEAVY SEAS.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: FLIGHTOPERATIONSINHEAVYSEASONUSSSHOUP
3. No title
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: GREYHOUNDSOFTHESEA
3. Title: GREYHOUNDS OF THE SEA
4. No description
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: GREYHOUNDSOFTHESEA
3. Title: USS SHOUP (DDG 86) IS THE 36TH SHIP IN THE ARLEIGH BURKE CLASS OF AEGIS GUIDED MISSILE DESTROYERS, AND THE EIGHTH FLIGHT IIA AEG
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: INTERNETCAFE OPENS
3. Title: USS SHOUP'S 'INTERNET CAFE'OPENS FOR BUSINESS
4. Description: USS SHOUP, AT SEA (NNS) -- USS SHOUP (DDG 86) CELEBRATED THE OPENING OF A NEW INTERNET CAFE JULY 22;ONE OF SEVERAL QUALITY OF LIFE UPGRADES ON BOARD IN PREPARATION FOR A DEPLOYMENT LATER THIS YEAR.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: INTERNETCAFE OPENS
3. Title: USS SHOUPS INTERNET CAFE OPENS FOR BUSINESS
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: LINCOLNSTRIKEGROUPTRAINSWITHSILENTPARTNER
3. Title: LINCOLN STRIKE GROUP TRAINS WITH SILENT PARTNER
4. Description: USS SHOUP, AT SEA (NNS) -- THE ABRAHAM LINCOLN CARRIER STRIKE GROUP, WITH THE ASSISTANCE OF FAST ATTACK SUBMARINE USS HAWAII (SSN 776), CONDUCTED AN ANTI-SUBMARINE WARFARE EXERCISE OFF THE COAST OF GUAM SEPT. 30-OCT. 1.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: LINCOLNSTRIKEGROUPTRAINSWITHSILENTPARTNER
3. Title: LINCOLN STRIKE GROUP TRAINS WITH SILENT PARTNER
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: MIDSHIPMENTRAININGABOARDUSSSHOUP
3. Title: MIDSHIPMEN TRAINING ABOARD USS SHOUP
4. Description: ABOARD USS SHOUP, AT SEA — USS SHOUP (DDG 86) RECENTLY HOSTED 14 MIDSHIPMEN FOR THEIR SUMMER ENLISTED CRUISE. THE CRUISE IS INTENDED TO GIVE THE FUTURE NAVAL OFFICERS AN UP-CLOSE LOOK AT SHIPBOARD LIFE.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: MIDSHIPMENTRAININGABOARDUSSSHOUP
3. Title: MIDSHIPMEN TRAINING ABOARD USS SHOUP
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: NAVSSES COMPLETES FIRST REMOTE HALOCARBON ALARM INSTALLATION ON DDG 51 CLASS
3. Title: NAVSSES COMPLETES FIRST REMOTE HALOCARBON ALARM INSTALLATION ON DDG 51 CLASS
4. No description
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: NAVSSES COMPLETES FIRST REMOTE HALOCARBON ALARM INSTALLATION ON DDG 51 CLASS
3. Title: NAVSSES COMPLETES FIRST REMOTE HALOCARBON ALARM INSTALLATION ON DDG 51 CLASS
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: NSECONDUCTSEXERCISECITADELPROTECT
3. Title: NSE CONDUCTS EXERCISE CITADEL PROTECT
4. Description: EVERETT, WASH. (NNS) — SAILORS ASSIGNED TO NAVAL STATION EVERETT (NSE) COORDINATED WITH TENANT COMMANDS AND LOCAL AUTHORITIES FOR THE ANTI-TERRORISM TRAINING EXERCISE CITADEL PROTECT.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: NSECONDUCTSEXERCISECITADELPROTECT
3. Title: NSE CONDUCTS EXERCISE CITADEL PROTECT
4. No description
5. No keywords
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: NAMESAKE
3. Title: NAMED FOR GENERAL DAVID M. SHOUP, USMC
4. Description: GENERAL DAVID MONROE SHOUP SERVED AS THE TWENTY-SECOND COMMANDANT OF THE MARINE CORPS FROM JANUARY 1, 1960 UNTIL HIS RETIREMENT FROM ACTIVE SERVICE, DECEMBER 31, 1963.
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: NEWS ARCHIVE
3. Title: NEWS ARCHIVE
4. No description
5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
6. Extension: ASPX


1. Path: SURFOR: DDG86: PAGES
2. File: OURSHIP
3. Title:
  • ABOUT US

  • 4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: PARTNERSHIP CANADIANALLY
    3. Title: SHOUP, HALSEY STRENGTHEN PARTNERSHIP WITH CANADIAN ALLY
    4. Description: LT. JACQUELYN R. BENGFORT, USS SHOUP PUBLIC AFFAIRS
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: PARTNERSHIP CANADIANALLY
    3. Title: SHOUP, HALSEY STRENGTHEN PARTNERSHIP WITH CANADIAN ALLY
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: PASTLEADERSHIP
    3. Title: PAST LEADERSHIP
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: PHOTOS
    3. Title: PHOTOS
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: SHOUP WARRIORS EARN THEIR EAWS PIN
    3. Title: SHOUP WARRIORS EARN THEIR EAWS PIN
    4. Description: ABOARD USS SHOUP, AT SEA – THE ENLISTED AVIATION WARFARE SPECIALIST (EAWS) INSIGNIA RECOGNIZES ENLISTED SAILOR’S PROFESSIONAL KNOWLEDGE AND MILITARY EXPERIENCE IN NAVAL AVIATION.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: SHOUP WARRIORS EARN THEIR EAWS PIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: SAILORS FROM US, INDIAN, CHILEAN NAVIES CONDUCT VBSS OPS DURING RIMPAC 2016
    3. Title: DDG 86
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: SAILORS FROM US, INDIAN, CHILEAN NAVIES CONDUCT VBSS OPS DURING RIMPAC 2016
    3. Title: SAILORS FROM US, INDIAN, CHILEAN NAVIES CONDUCT VBSS OPS DURING RIMPAC 2016
    4. Description: PACIFIC OCEAN (NNS) -- SAILORS ASSIGNED TO ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS SHOUP (DDG 86) CONDUCTED A VISIT, BOARD, SEARCH AND SEIZURE (VBSS) TRAINING EXERCISE
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: SAILORSFROMUSSSHOUPSTARTGLASSORGANIZATION
    3. Title: SAILORS FROM USS SHOUP START GLASS ORGANIZATION
    4. Description: USS SHOUP, AT SEA - SAILORS FROM GUIDED-MISSILE DESTROYER USS SHOUP (DDG 86) HAVE ESTABLISHED ONE OF THE FIRST GAY, LESBIAN, AND SUPPORTING SAILORS (GLASS) ORGANIZATIONS ON BOARD A U.S. NAVY VESSEL.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: SAILORSFROMUSSSHOUPSTARTGLASSORGANIZATION
    3. Title: SAILORS FROM USS SHOUP START GLASS ORGANIZATION
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: SAN DIEGO HOSTS DOWNTOWN SHIP TOURS
    3. Title: SAN DIEGO HOSTS DOWNTOWN SHIP TOURS
    4. Description: THE GUIDED-MISSILE DESTROYER USS SHOUP (DDG 86) OPENED ITS DOORS TO MORE THAN 2,000 SAN DIEGO RESIDENTS AND TOURISTS WHILE MOORED AT THE BROADWAY PIER IN DOWNTOWN SAN DIEGO. THE VISIT OCCURED FOLLOWING THE NAVY'S 240TH BIRTHDAY.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: SAN DIEGO HOSTS DOWNTOWN SHIP TOURS
    3. Title: USS SHOUP
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: SEATTLE 60THSEAFAIRCELEBRATION
    3. Title: USS SHOUP (DDG 86) ARRIVES IN SEATTLE FOR THE 60TH SEAFAIR CELEBRATION
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: SEATTLE 60THSEAFAIRCELEBRATION
    3. Title: USS SHOUP (DDG 86) ARRIVES IN SEATTLE FOR THE 60TH SEAFAIR CELEBRATION
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: SHOUP RECEIVES RETENTION EXCELLENCE AWARD, RECOGNIZES CAREER COUNSELOR
    3. Title: SHOUP RECEIVES RETENTION EXCELLENCE AWARD, RECOGNIZES CAREER COUNSELOR
    4. Description: EVERETT, WASH. - NAVY COUNSELOR 1ST CLASS AMIE MCCOLLUM, COMMAND CAREER COUNSELOR FOR USS SHOUP (DDG 86), PAINTS THE SHIP'S ANCHOR GOLD IN RECOGNITION OF SHOUP'S SELECTION AS A WINNER OF THE 2015 RETENTION EXCELLENCE AWARD.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: SHOUP RECEIVES RETENTION EXCELLENCE AWARD, RECOGNIZES CAREER COUNSELOR
    3. Title: SHOUP RECEIVES RETENTION EXCELLENCE AWARD, RECOGNIZES CAREER COUNSELOR
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: SHOUPPARTICIPATESINNAVALSTATIONEVERETT(NSE)FREEDOMFEST2012
    3. Title: SHOUP PARTICIPATES IN NAVAL STATION EVERETT (NSE) FREEDOM FEST 2012
    4. Description: AVIATION SUPPORT EQUIPMENT TECHNICIAN 1ST CLASS (AW) ARLENE YOUNG HANDS OUT TICKETS FOR A TOUR ABOARD THE GUIDED-MISSILE DESTROYER USS SHOUP (DDG 86) DURING NAVAL STATION EVERETT (NSE) FREEDOM FEST 2012.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: SHOUPPARTICIPATESINNAVALSTATIONEVERETT(NSE)FREEDOMFEST2012
    3. Title: USS SHOUP PARTICIPATES IN NAVAL STATION EVERETT FREEDOM FEST 2012
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: TN CADETS TOURUSSSHOUP
    3. Title: TENNESSEE CADETS TOUR AIR STATION, USS SHOUP
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: TN CADETS TOURUSSSHOUP
    3. Title: TENNESSEE CADETS TOUR AIR STATION, USS SHOUP
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP ARRIVES IN AMERICAN SAMOA AS PART OF OMSI DEPLOYMENT
    3. Title: USS SHOUP ARRIVES IN AMERICAN SAMOA AS PART OF OMSI DEPLOYMENT
    4. Description: PAGO PAGO, AMERICAN SAMOA - GUIDED-MISSILE DESTROYER USS SHOUP (DDG 86) ARRIVED IN PAGO PAGO OCTOBER 27 AS PART OF THE SHIP’S OCEANIA MARITIME SECURITY INITIATIVE (OMSI) DEPLOYMENT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP ARRIVES IN AMERICAN SAMOA AS PART OF OMSI DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP HOLDS CHANGE OF COMMAND CEREMONY
    3. Title: USS SHOUP HOLDS CHANGE OF COMMAND CEREMONY
    4. Description: THE CREW OF THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS SHOUP (DDG 86) HELD A CHANGE OF COMMAND CEREMONY ON THE FLIGHT DECK WHILE MOORED AT NAVAL BASE GUAM SEPT. 23, 2018.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP HOLDS CHANGE OF COMMAND CEREMONY
    3. Title: DDDG86
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP MIDN SUMMER CRUISE
    3. Title: USS SHOUP MIDSHIPMEN SUMMER CRUISE
    4. Description: PACIFIC NORTHWEST, WASHINGTON – 16 MIDSHIPMEN FROM VARIOUS NAVAL RESERVE OFFICER TRAINING CORPS (NROTC) UNITS AND THE UNITED STATES NAVAL ACADEMY ARE CURRENTLY EMBARKED ON USS SHOUP (DDG 86) AS PART OF THEIR SUMMER TRAINING.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP MIDN SUMMER CRUISE
    3. Title: USS SHOUP MIDSHIPMEN SUMMER CRUISE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP BUILDS MULTINATIONAL PARTNERSHIPS
    3. Title: USS SHOUP BUILDS MULTINATIONAL PARTNERSHIPS
    4. Description: THE U.S. NAVY'S GUIDED-MISSILE DESTROYER USS SHOUP (DDG 86), THE U.K. ROYAL NAVY'S DUKE-CLASS FRIGATE HMS MONMOUTH (F 235), AND THE FRENCH MARINE NATIONALE'S ANTI-AIR DESTROYER FS JEAN BART (D 615) PARTICIPATED IN THE EXERCISE.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP BUILDS MULTINATIONAL PARTNERSHIPS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP DEPARTS PAGO PAGO AMERICAN SAMOA
    3. Title: USS SHOUP DEPARTS PAGO PAGO AMERICAN SAMOA
    4. Description: PAGO PAGO, AMERICAN SAMOA – THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS SHOUP (DDG 86) VISITED THE PORT OF PAGO PAGO, AMERICAN SAMOA TO PAUSE FROM OPERATIONS IN THE WESTERN PACIFIC OCTOBER 27–30.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP DEPARTS PAGO PAGO AMERICAN SAMOA
    3. Title: USS SHOUP DEPARTS PAGO PAGO AMERICAN SAMOA
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP DEPARTS SUVA FIJI
    3. Title: USS SHOUP DEPARTS SUVA FIJI
    4. Description: SUVA, FIJI - GUIDED-MISSILE DESTROYER USS SHOUP (DDG 86) DEPARTED FROM SUVA, FIJI, OCTOBER 17 FOLLOWING A PORT VISIT THAT CELEBRATED DECADES OF FIJI-AMERICAN NAVAL PARTNERSHIP.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP DEPARTS SUVA FIJI
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP HOLDS CHANGE OF COMMAND
    3. Title: USS SHOUP (DDG86)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP HOLDS CHANGE OF COMMAND
    3. Title: USS SHOUP HOLDS CHANGE OF COMMAND
    4. Description: SAN DIEGO, CA – THE CREW OF ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS SHOUP (DDG 86) CONDUCTED A CHANGE OF COMMAND CEREMONY ON THE SHIP’S FORECASTLE AT NAVAL BASE SAN DIEGO, MAR.16.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP HOLDS FLIGHT DECK RECEPTION IN SUVA FIJI
    3. Title: USS SHOUP HOLDS FLIGHT DECK RECEPTION IN SUVA FIJI
    4. Description: ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS SHOUP (DDG 86) HOSTED MORE THAN 150 MILITARY AND CIVILIAN DIGNITARIES FROM THE UNITED STATES, FIJI, AUSTRALIA, UNITED KINGDOM, SPAIN, NEW ZEALAND AND JAPAN DURING A RECEPTION ON THE FLIGHT DECK OCTOBER 15.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP HOLDS FLIGHT DECK RECEPTION IN SUVA FIJI
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP PUBLIC SHIP TOUR
    3. Title: BROADWAY VISIT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP PUBLIC SHIP TOUR
    3. Title: USS SHOUP PUBLIC SHIP TOUR
    4. Description: THE GUIDED-MISSILE DESTROYER USS SHOUP (DDG 86) IS SCHEDULED TO BE OPEN FOR PUBLIC VISITS AT BROADWAY PIER, OCT. 17 AND 18. THE VISIT OCCURS THE WEEKEND FOLLOWING THE NAVY’S 240TH BIRTHDAY.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP RETURNS FROM DEPLOYMENT
    3. Title: USS SHOUP RETURNS FROM DEPLOYMENT
    4. Description: EVERETT – ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS SHOUP (DDG 86) RETURNED TO ITS HOMEPORT OF NAVAL STATION EVERETT, WASHINGTON, NOVEMBER 21.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP RETURNS FROM DEPLOYMENT
    3. Title: DDG86
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP RETURNS HOME TO EVERETT FROM DEPLOYMENT
    3. Title: USS SHOUP RETURNS HOME TO EVERETT FROM DEPLOYMENT
    4. Description: EVERETT, WASH. - THE GUIDED-MISSILE DESTROYER USS SHOUP (DDG 86) RETURNED TO NAVAL STATION EVERETT FROM A SCHEDULED SIX-MONTH DEPLOYMENT WITH THE NIMITZ CARRIER STRIKE GROUP TO THE INDO-ASIA-PACIFIC REGION AND THE ARABIAN GULF.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP RETURNS HOME TO EVERETT FROM DEPLOYMENT
    3. Title: DDG86
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP VISITS FIJI TO PROMOTE MARITIME SECURITY
    3. Title: USS SHOUP VISITS FIJI TO PROMOTE MARITIME SECURITY
    4. Description: SUVA, FIJI - THE GUIDED-MISSILE DESTROYER USS SHOUP (DDG 86) ARRIVED IN SUVA, OCT. 3, AS PART OF THE SHIP’S OCEANIA MARITIME SECURITY INITIATIVE (OMSI) DEPLOYMENT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP VISITS FIJI TO PROMOTE MARITIME SECURITY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPHOLDSCHANGEOFCOMMAND
    3. Title: USS SHOUP HOLDS CHANGE OF COMMAND
    4. Description: USS SHOUP EVERETT, WASHINGTON – CDR RAFAEL A. ACEVEDO, WAS RELIEVED BY CDR JILL R. CESARI IN A CHANGE OF COMMAND CEREMONY ONBOARD USS SHOUP AT NAVAL STATION EVERETT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPHOLDSCHANGEOFCOMMAND
    3. Title: USS SHOUP CHANGE OF COMMAND CEREMONY ON DECEMBER 12, 2012
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPADDSREALISMTOEGRESSTRAINING
    3. Title: USS SHOUP (DDG 86)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPADDSREALISMTOEGRESSTRAINING
    3. Title: USS SHOUP (DDG86) ADDS REALISM TO EGRESS TRAINING
    4. Description: USS SHOUP, AT SEA (NNS) -- USS SHOUP (DDG 86) CONDUCTED A SERIES OF SHIPBOARD EMERGENCY EGRESS TRAINING SESSIONS SEP. 20-25 DURING ITS CURRENT DEPLOYMENT WITH ABRAHAM LINCOLN CARRIER STRIKE GROUP (CSG) 9.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPARRIVESINWESTERNAUSTRALIA
    3. Title: USS SHOUP (DDG 86) COMMANDING OFFICER CMDR. JOE NADEAU HOLDS A MEDIA AVAILABILITY CONFERENCE WITH LOCAL REPORTERS IN FREMANTLE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPARRIVESINWESTERNAUSTRALIA
    3. Title: USS SHOUP ARRIVES IN WESTERN AUSTRALIA
    4. Description: FREMANTLE, AUSTRALIA (FEB. 15, 2011) -THE GUIDED-MISSILE DESTROYER USS SHOUP (DDG 86) COMMANDING OFFICER CMDR. JOE NADEAU HOLDS A MEDIA AVAILABILITY CONFERENCE WITH LOCAL REPORTERS IN FREMANTLE, AUSTRALIA, UPON THE SHIPS ARRIVAL FOR A PORT VISIT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPCONDUCTSBURIALATSEA
    3. Title: USS SHOUP CONDUCTS BURIAL AT SEA
    4. Description: USS SHOUP AT SEA - YEOMAN 3RD CLASS ANDREA BURKS AND OPERATIONS SPECIALIST 2ND CLASS BRIAN HANSEN PRESENT ASHES TO USS SHOUP'S EXECUTIVE OFFICER, COMMANDER BRYANT TROST DURING A BURIAL AT SEA CEREMONY WHILE OFF THE COAST OF SOUTHERN CALIFORNIA.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPCONDUCTSBURIALATSEA
    3. Title: USS SHOUP CONDUCTS BURIAL AT SEA
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPCONDUCTSPASSEXWITHJMSDFTRAININGSQUADRON
    3. Title: USS SHOUP CONDUCTS PASSEX WITH JMSDF TRAINING SQUADRON
    4. Description: SAN DIEGO – THE CREW OF THE GUIDED MISSILE DESTROYER USS SHOUP (DDG 86) AND SAILORS FROM SHIPS ASSIGNED TO THE JAPAN MARITIME SELF-DEFENSE FORCE (JMSDF) TRAINING SQUADRON CONDUCTED SUCCESSFUL TACTICAL MANEUVERING EXERCISES.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPCONDUCTSPASSEXWITHJMSDFTRAININGSQUADRON
    3. Title: USS SHOUP CONDUCTS PASSEX WITH JMSDF TRAINING SQUADRON
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPHOLDSFIREDRILLINSHIPYARD
    3. Title: USS SHOUP HOLDS FIRE DRILL IN SHIPYARD
    4. Description: EVERETT, WASH. – THE CREW OF THE GUIDED MISSILE DESTROYER USS SHOUP (DDG 86), ALONG WITH THE NAVAL STATION EVERETT (NSE) FIRE DEPARTMENT AND CITY OF EVERETT FIRE DEPARTMENT, CONDUCTED A SHIPYARD FIRE DRILL TO PRACTICE COORDINATION BETWEEN THE DIFFERENT ORGANIZATIONS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPHOLDSFIREDRILLINSHIPYARD
    3. Title: USS SHOUP HOLDS FIRE DRILL IN SHIPYARD
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPJUNIOROFFICERSEXPERIENCESHIPHANDLINGTRAINER
    3. Title: USS SHOUP JUNIOR OFFICERS EXPERIENCE SHIPHANDLING TRAINER
    4. Description: EVERETT, WASH. - “ALL ENGINES BACK ONE-THIRD,” ORDERS ENSIGN MADILYN MACFARLANE, ASSIGNED TO USS SHOUP (DDG 86), AS THE WARSHIP STEAMS IN AT FOUR KNOTS WHILE APPROACHING THE PIER.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPJUNIOROFFICERSEXPERIENCESHIPHANDLINGTRAINER
    3. Title: USS SHOUP JUNIOR OFFICERS EXPERIENCE SHIPHANDLING TRAINER
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPPERFORMS22BURIALSATSEA
    3. Title: USS SHOUP PERFORMS 22 BURIALS AT SEA
    4. Description: USS SHOUP (DDG 86) HAD THE HONOR OF BURYING 22 VETERANS AND DEPENDENTS WHILE SAILING THROUGH THE PUGET SOUND. THE CEREMONY TOOK PLACE ON THE FLIGHT DECK.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPPERFORMS22BURIALSATSEA
    3. Title: USS SHOUP PERFORMS 22 BURIALS AT SEA
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPPROVESITSAFORCETOBERECKONEDWITH
    3. Title: USS SHOUP MISSILE SHOOT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPPROVESITSAFORCETOBERECKONEDWITH
    3. Title: USS SHOUP PROVES ITS A FORCE TO BE RECKONED WITH
    4. Description: USS SHOUP, AT SEA – AFTER SPENDING TWO WEEKS TESTING MOST OF HER MAJOR WEAPONS SYSTEMS IN THE SOUTHERN CALIFORNIA NAVAL OPERATING AREA, USS SHOUP SHOT TWO TOMAHAWK MISSILES, ONE ON EACH OF THE MORNINGS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPRETURNFROMDEPLOYMENT
    3. Title: USS SHOUP RETURNS FROM DEPLOYMENT
    4. Description: USS SHOUP PROUDLY DISPLAYS HER 247 FT LONG HOMEWARD BOUND PENNANT UPON ARRIVAL EVERETT, WA ROM A 310 DAY DEPLOYMENT TO 5TH FLEET.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPRETURNFROMDEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPANDHSM75RETURNFOLLOWINGEXTENDEDDEPLOYMENT
    3. Title: USS SHOUP AND HSM 75 RETURN FOLLOWING EXTENDED DEPLOYMENT
    4. Description: SAN DIEGO - THE ARLEIGH-BURKE CLASS GUIDED-MISSILE DESTROYER USS SHOUP (DDG 86) IS SCHEDULED TO RETURN TO ITS HOMEPORT OF NAVAL STATION EVERETT NOV. 18 FOLLOWING AN EXTENDED DEPLOYMENT TO THE U.S. 5TH, 6TH AND 7TH FLEET AREAS OF RESPONSIBILITY (AOR).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USSSHOUPANDHSM75RETURNFOLLOWINGEXTENDEDDEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: WELCOME
    3. Title: WELCOME ABOARD
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO1 2JUN2014 24NOV2015
    3. Title: CDR BRYANT P. TROST
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO1 2JUN2014 24NOV2015
    3. Title: CDR BRYANT P. TROST
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO1 2JUNE2014 24SEPTEMBER2018
    3. Title: CDR TED W. WIEDERHOLT
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO1 2JUNE2014 24SEPTEMBER2018
    3. Title: COMMANDER TED WIEDERHOLT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO1 5NOVEMBER2018 8JUNE2020
    3. Title: (NOVEMBER 6, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO1 5NOVEMBER2018 8JUNE2020
    3. Title: CDR JAMES ANDREW STRICKLAND
    4. Description: CURRENT COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO1 DEC09 JUNE11
    3. Title: CDR JOE NADEAU
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO1 DEC09 JUNE11
    3. Title: CDR JOE NADEAU
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO1 RELIEVED JUNE11 12DECEMBER12
    3. Title: CDR RAY ACEVEDO
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO1 RELIEVED JUNE11 12DECEMBER12
    3. Title: CDR RAY ACEVEDO
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO1
    3. Title: CDR SAM HERBST
    4. Description: CURRENT COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO1
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO2 1OCTOBER2015 25MAY2018
    3. Title: CDR JAMES ANDREW STRICKLAND
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO2 1OCTOBER2015 25MAY2018
    3. Title: OCTOBER 1, 2015 - PRESENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO2 1OCTOBER2015 27DECEMBER2016
    3. Title: CDR TED WIEDERHOLT
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO2 1OCTOBER2015 27DECEMBER2016
    3. Title: EXECUTIVE OFFICER (OCTOBER 1, 2015 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO2 26MAY2018 5MARCH2020
    3. Title: (JUNE 26, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO2 26MAY2018 5MARCH2020
    3. Title: CDR SAM HERBST
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO2 9MAY2014 30SEPT2015
    3. Title: CDR JEFFREY D. STURM
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO2 9MAY2014 30SEPT2015
    3. Title: CDR JEFFREY D. STURM
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO2 RELIEVED 29APRIL11 12DEC12
    3. Title: CDR JILL CESARI
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO2 RELIEVED 29APRIL11 12DEC12
    3. Title: CDR JILL CESARI
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO2
    3. Title: CDR VIC BOZA
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO2
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO3 16AUGUST2013 7MAY2016
    3. Title: CMDCM(SW/AW) RICHARD L. MENGEL
    4. Description: COMMAND MASTER CHIEF
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO3 16AUGUST2013 7MAY2016
    3. Title: COMMAND MASTER CHIEF (AUGUST 2013 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO3 8JUNE2016 27JULY2018
    3. Title: (MAY 8, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO3 8JUNE2016 27JULY2018
    3. Title: CMDCM(SW) MARIA P. STRADER
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO3 JUNE10 JUNE11
    3. Title: ENCS(SW/AW) ROY EDWARD NEAL
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO3 JUNE10 JUNE11
    3. Title: ENCS(SW/AW) ROY EDWARD NEAL
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO3
    3. Title: CMDCM KEVIN R. LOHRKE
    4. Description: COMMAND MASTER CHIEF
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: BIO3
    3. Title: JULY 28, 2018 - PRESENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: DEFAULT
    3. Title: USS SHOUP (DDG 86)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: DEFAULT
    3. Title: USS SHOUP (DDG 86)
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: OURSHIP
    3. Title: ABOUT US
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: SHOUP CREW CELEBRATES REOPENING OF GALLEY
    3. Title: SHOUP CREW CELEBRATES REOPENING OF GALLEY
    4. Description: EVERETT, WASH. - (LEFT TO RIGHT) CULINARY SPECIALIST 3RD CLASS MCHALE JOHNSON, CULINARY SPECIALIST 3RD CLASS JERON K. PETERSEN, CMDR. BRYANT P. TROST, COMMANDING OFFICER OF USS SHOUP (DDG 86), AND CULINARY SPECIALIST SEAMAN ESAIE LIRA CELEBRATE THE REOPENING OF SHOUP'S GALLEY WITH A CAKE CUTTING.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: SHOUP CREW CELEBRATES REOPENING OF GALLEY
    3. Title: SHOUP CREW CELEBRATES REOPENING OF GALLEY
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: SHOUP CREW COMPLETES SEA TRIALS ENTERS BASIC PHASE OF TRAINING
    3. Title: SHOUP CREW COMPLETES SEA TRIALS, ENTERS BASIC PHASE OF TRAINING
    4. Description: EVERETT, WASH. - THE GUIDED MISSILE DESTROYER USS SHOUP (DDG 86) DEPARTED NAVAL STATION EVERETT FOR THE FIRST TIME SINCE JULY 2014 TO COMPLETE TYPE COMMANDER (TYCOM) SEA TRIALS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: SHOUP CREW COMPLETES SEA TRIALS ENTERS BASIC PHASE OF TRAINING
    3. Title: SHOUP CREW COMPLETES SEA TRIALS, ENTERS BASIC PHASE OF TRAINING
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: SHOUP CREW PERSEVERES THROUGH SRA PERIOD
    3. Title: SHOUP CREW PERSEVERES THROUGH SRA PERIOD
    4. Description: EVERETT, WASHINGTON - THE CREW OF THE GUIDED MISSILE DESTROYER USS SHOUP (DDG 86) WORKS TO INSTALL THE SHIP'S ANCHOR FOLLOWING SUCCESSFUL COMPLETION OF A SIX-MONTH SHIP'S RESTRICTED AVAILABILITY MAINTENANCE PERIOD.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: SHOUP CREW PERSEVERES THROUGH SRA PERIOD
    3. Title: SHOUP CREW PERSEVERES THROUGH SRA PERIOD
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP COMPLETES LIGHT OFF ASSESSMENT
    3. Title: USS SHOUP COMPLETES LIGHT-OFF ASSESSMENT
    4. Description: EVERETT, WASHINGTON – THE CREW OF THE GUIDED MISSILE DESTROYER USS SHOP (DDG 86) SUCCESSFULLY COMPLETED THEIR LIGHT-OFF ASSESSMENT (LOA) EVENT FOLLOWING AN EXTENSIVE MAINTENANCE PERIOD.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PAGES
    2. File: USS SHOUP COMPLETES LIGHT OFF ASSESSMENT
    3. Title: USS SHOUP COMPLETES LIGHT-OFF ASSESSMENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: PHOTOS
    2. File: 090728 SHOUP 60TH SEAFAIR
    3. Title: THE ARLEIGH BURKE-CLASS DESTROYER USS SHOUP (DDG 86) ARRIVES IN SEATTLE FOR THE 60TH SEAFAIR CELEBRATION. SAILORS WILL HAVE THE
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PHOTOS
    2. File: 110215 N XXXXN 002
    3. Title: USS SHOUP (DDG 86) COMMANDING OFFICER CMDR. JOE NADEAU HOLDS A MEDIA AVAILABILITY CONFERENCE WITH LOCAL REPORTERS IN FREMANTLE
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PHOTOS
    2. File: USS SHOUP
    3. Title: USS SHOUP (DDG 86)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PHOTOS
    2. File: WEB 100919 N 4997L 092
    3. Title: LINCOLN STRIKE GROUP TRAINS WITH SILENT PARTNER
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: 170315 N BY095 227
    3. Title: USS SHOUP (DDG86)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: 590PX GENDMSHOUP USMC
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: BOZA BIG
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: BOZA SMALL
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: CDR ACEVEDO
    3. Title: CDR RAY ACEVEDO
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: CDR WIEDERHOLT CO
    3. Title: COMMANDER TED WIEDERHOLT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: CDRSTRICKLAND SMALL
    3. Title: (NOVEMBER 6, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: CDRSTRICKLAND
    3. Title: (NOVEMBER 6, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: CMC BOND
    3. Title: CMDCM(SW/AW/FMF) CHARLES ANSON BOND
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: CMC HELWICK
    3. Title: CMDCM RICK A. HELWICK
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: CMC MENGEL SMALL
    3. Title: COMMAND MASTER CHIEF (AUGUST 2013 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: CMC MENGEL
    3. Title: COMMAND MASTER CHIEF (AUGUST 2013 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: CMC NEAL
    3. Title: ENCS(SW/AW) ROY EDWARD NEAL
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: CMDCM STRADER SMALL
    3. Title: (MAY 8, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: CMDCM STRADER
    3. Title: (MAY 8, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: CO NADEAU
    3. Title: CDR JOE NADEAU
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: CO ROGERS SMALL
    3. Title: COMMANDING OFFICER (NOVEMBER 25, 2015 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: CO ROGERS
    3. Title: COMMANDING OFFICER (NOVEMBER 25, 2015 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: CO TROST
    3. Title: CDR BRYANT P. TROST
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: CESARI BIO PHOTO
    3. Title: CDR JILL CESARI
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: HERBST BIG
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: HERBST SMALL
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: SHOUP HOMEPG COLLAGE
    3. Title: USS SHOUP (DDG 86) IS THE 36TH SHIP IN THE ARLEIGH BURKE CLASS OF AEGIS GUIDED MISSILE DESTROYERS, AND THE EIGHTH FLIGHT IIA AEG
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: STRICKLAND JAMES SMALL
    3. Title: OCTOBER 1, 2015 - PRESENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: STRICKLAND JAMES
    3. Title: OCTOBER 1, 2015 - PRESENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: XO STURM SMALL
    3. Title: CDR JEFFREY D. STURM
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: XO STURM
    3. Title: CDR JEFFREY D. STURM
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: XO WIEDERHOLT SMALL
    3. Title: EXECUTIVE OFFICER (OCTOBER 1, 2015 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: XO WIEDERHOLT
    3. Title: EXECUTIVE OFFICER (OCTOBER 1, 2015 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: XO DDG86 THUMBNAIL
    3. Title: CDR BRYANT P. TROST
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: XO DDG86
    3. Title: CDR BRYANT P. TROST
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: CDR HERBST SMALL
    3. Title: (JUNE 26, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: CDR HERBST
    3. Title: (JUNE 26, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: CMC LOHRKE SMALL
    3. Title: JULY 28, 2018 - PRESENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: CMC LOHRKE
    3. Title: JULY 28, 2018 - PRESENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: DDG86 CESARI THUMBNAIL
    3. Title: CDR JILL CESARI
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: DDG86 CESARI
    3. Title: CDR JILL CESARI
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: PUBLISHINGIMAGES
    2. File: DDG86BROADWAYVISIT
    3. Title: BROADWAY VISIT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: AFLOATCOLLEGEPROGRAMDELIVERSSCHOOL
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: AFLOATCOLLEGEPROGRAMDELIVERSSCHOOL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BATTLEE 2009
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BATTLEE 2009
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO1 12DEC2012 JUNE2014
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO1 12DEC2012 JUNE2014
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO1 24NOV2015 16MAR2017
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO1 24NOV2015 16MAR2017
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO1
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO1
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO2 DEC2012 08MAY2014
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO2 DEC2012 08MAY2014
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO2 RELIEVEDAPR2011
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO2 RELIEVEDAPR2011
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO3 APR2009 APR2011
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO3 APR2009 APR2011
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO3 AUG2013 NOV2013
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO3 AUG2013 NOV2013
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO3 JUN2011 AUG2013
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO3 JUN2011 AUG2013
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: CJTF HOAOFFICERSVISIT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: CJTF HOAOFFICERSVISIT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: CONGRESSMANVISITSUSSSHOUP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: CONGRESSMANVISITSUSSSHOUP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: FAMILY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: FAMILY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: FIRESFOREFFECT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: FIRESFOREFFECT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: FLIGHTOPERATIONSINHEAVYSEASONUSSSHOUP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: FLIGHTOPERATIONSINHEAVYSEASONUSSSHOUP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: GREYHOUNDSOFTHESEA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: GREYHOUNDSOFTHESEA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: INTERNETCAFE OPENS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: INTERNETCAFE OPENS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: LINCOLNSTRIKEGROUPTRAINSWITHSILENTPARTNER
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: LINCOLNSTRIKEGROUPTRAINSWITHSILENTPARTNER
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: MIDSHIPMENTRAININGABOARDUSSSHOUP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: MIDSHIPMENTRAININGABOARDUSSSHOUP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: NAVSSES COMPLETES FIRST REMOTE HALOCARBON ALARM INSTALLATION ON DDG 51 CLASS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: NAVSSES COMPLETES FIRST REMOTE HALOCARBON ALARM INSTALLATION ON DDG 51 CLASS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: NSECONDUCTSEXERCISECITADELPROTECT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: NSECONDUCTSEXERCISECITADELPROTECT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: NAMESAKE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: NAMESAKE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: NEWS ARCHIVE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: NEWS ARCHIVE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: PARTNERSHIP CANADIANALLY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: PARTNERSHIP CANADIANALLY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: PASTLEADERSHIP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: PASTLEADERSHIP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: PHOTOS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: PHOTOS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: SHOUP WARRIORS EARN THEIR EAWS PIN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: SHOUP WARRIORS EARN THEIR EAWS PIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: SAILORS FROM US, INDIAN, CHILEAN NAVIES CONDUCT VBSS OPS DURING RIMPAC 2016
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: SAILORS FROM US, INDIAN, CHILEAN NAVIES CONDUCT VBSS OPS DURING RIMPAC 2016
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: SAILORSFROMUSSSHOUPSTARTGLASSORGANIZATION
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: SAILORSFROMUSSSHOUPSTARTGLASSORGANIZATION
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: SAN DIEGO HOSTS DOWNTOWN SHIP TOURS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: SAN DIEGO HOSTS DOWNTOWN SHIP TOURS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: SEATTLE 60THSEAFAIRCELEBRATION
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: SEATTLE 60THSEAFAIRCELEBRATION
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: SHOUP RECEIVES RETENTION EXCELLENCE AWARD, RECOGNIZES CAREER COUNSELOR
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: SHOUP RECEIVES RETENTION EXCELLENCE AWARD, RECOGNIZES CAREER COUNSELOR
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: SHOUPPARTICIPATESINNAVALSTATIONEVERETT(NSE)FREEDOMFEST2012
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: SHOUPPARTICIPATESINNAVALSTATIONEVERETT(NSE)FREEDOMFEST2012
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: TN CADETS TOURUSSSHOUP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: TN CADETS TOURUSSSHOUP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP ARRIVES IN AMERICAN SAMOA AS PART OF OMSI DEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP ARRIVES IN AMERICAN SAMOA AS PART OF OMSI DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP HOLDS CHANGE OF COMMAND CEREMONY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP HOLDS CHANGE OF COMMAND CEREMONY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP MIDN SUMMER CRUISE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP MIDN SUMMER CRUISE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP BUILDS MULTINATIONAL PARTNERSHIPS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP BUILDS MULTINATIONAL PARTNERSHIPS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP DEPARTS PAGO PAGO AMERICAN SAMOA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP DEPARTS PAGO PAGO AMERICAN SAMOA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP DEPARTS SUVA FIJI
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP DEPARTS SUVA FIJI
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP HOLDS CHANGE OF COMMAND
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP HOLDS CHANGE OF COMMAND
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP HOLDS FLIGHT DECK RECEPTION IN SUVA FIJI
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP HOLDS FLIGHT DECK RECEPTION IN SUVA FIJI
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP PUBLIC SHIP TOUR
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP PUBLIC SHIP TOUR
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP RETURNS FROM DEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP RETURNS FROM DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP RETURNS HOME TO EVERETT FROM DEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP RETURNS HOME TO EVERETT FROM DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP VISITS FIJI TO PROMOTE MARITIME SECURITY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP VISITS FIJI TO PROMOTE MARITIME SECURITY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPHOLDSCHANGEOFCOMMAND
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPHOLDSCHANGEOFCOMMAND
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPADDSREALISMTOEGRESSTRAINING
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPADDSREALISMTOEGRESSTRAINING
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPARRIVESINWESTERNAUSTRALIA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPARRIVESINWESTERNAUSTRALIA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPCONDUCTSBURIALATSEA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPCONDUCTSBURIALATSEA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPCONDUCTSPASSEXWITHJMSDFTRAININGSQUADRON
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPCONDUCTSPASSEXWITHJMSDFTRAININGSQUADRON
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPHOLDSFIREDRILLINSHIPYARD
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPHOLDSFIREDRILLINSHIPYARD
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPJUNIOROFFICERSEXPERIENCESHIPHANDLINGTRAINER
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPJUNIOROFFICERSEXPERIENCESHIPHANDLINGTRAINER
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPPERFORMS22BURIALSATSEA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPPERFORMS22BURIALSATSEA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPPROVESITSAFORCETOBERECKONEDWITH
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPPROVESITSAFORCETOBERECKONEDWITH
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPRETURNFROMDEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPRETURNFROMDEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPANDHSM75RETURNFOLLOWINGEXTENDEDDEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USSSHOUPANDHSM75RETURNFOLLOWINGEXTENDEDDEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: WELCOME
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: WELCOME
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO1 2JUN2014 24NOV2015
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO1 2JUN2014 24NOV2015
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO1 2JUNE2014 24SEPTEMBER2018
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO1 2JUNE2014 24SEPTEMBER2018
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO1 5NOVEMBER2018 8JUNE2020
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO1 5NOVEMBER2018 8JUNE2020
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO1 DEC09 JUNE11
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO1 DEC09 JUNE11
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO1 RELIEVED JUNE11 12DECEMBER12
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO1 RELIEVED JUNE11 12DECEMBER12
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO1
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO1
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO2 1OCTOBER2015 25MAY2018
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO2 1OCTOBER2015 25MAY2018
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO2 1OCTOBER2015 27DECEMBER2016
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO2 1OCTOBER2015 27DECEMBER2016
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO2 26MAY2018 5MARCH2020
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO2 26MAY2018 5MARCH2020
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO2 9MAY2014 30SEPT2015
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO2 9MAY2014 30SEPT2015
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO2 RELIEVED 29APRIL11 12DEC12
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO2 RELIEVED 29APRIL11 12DEC12
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO2
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO2
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO3 16AUGUST2013 7MAY2016
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO3 16AUGUST2013 7MAY2016
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO3 8JUNE2016 27JULY2018
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO3 8JUNE2016 27JULY2018
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO3 JUNE10 JUNE11
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO3 JUNE10 JUNE11
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO3
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: BIO3
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: DEFAULT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: DEFAULT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: SHOUP CREW CELEBRATES REOPENING OF GALLEY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: SHOUP CREW CELEBRATES REOPENING OF GALLEY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: SHOUP CREW COMPLETES SEA TRIALS ENTERS BASIC PHASE OF TRAINING
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: SHOUP CREW COMPLETES SEA TRIALS ENTERS BASIC PHASE OF TRAINING
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: SHOUP CREW PERSEVERES THROUGH SRA PERIOD
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: SHOUP CREW PERSEVERES THROUGH SRA PERIOD
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP COMPLETES LIGHT OFF ASSESSMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86: LAYOUTS: AUTHENTICATE
    2. File: USS SHOUP COMPLETES LIGHT OFF ASSESSMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG86
    2. No filename (redirect)
    3. Title: USS SHOUP
    4. No description
    5. No keywords
    6. No extension (redirect)


    1. Path: SURFOR: DDG88: DOCUMENTS
    2. File: AMPMC
    3. Title: AMERICAS MOST PREPARED MILITARY COMMUNITY BRIEF
    4. No description
    5. No keywords
    6. Extension: PPT


    1. Path: SURFOR: DDG88: DOCUMENTS
    2. File: AMPMC
    3. No title
    4. No description
    5. No keywords
    6. Extension: PPT


    1. Path: SURFOR: DDG88: DOCUMENTS
    2. File: DISASTER PREP PLAN
    3. Title: PREBLES DISASTER PREPAREDNESS PLAN
    4. No description
    5. No keywords
    6. Extension: PDF


    1. Path: SURFOR: DDG88: DOCUMENTS
    2. File: DISASTER PREP PLAN
    3. No title
    4. No description
    5. No keywords
    6. Extension: PDF


    1. Path: SURFOR: DDG88: DOCUMENTS
    2. File: FRG
    3. Title: FAMILY READINESS GROUP INFORMATION
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG88: DOCUMENTS
    2. File: FRG
    3. No title
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG88: DOCUMENTS
    2. File: YAHOO GROUP INFO
    3. Title: YAHOO GROUP INSTRUCTIONS
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG88: DOCUMENTS
    2. File: YAHOO GROUP INFO
    3. No title
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG88: DOCUMENTS
    2. File: READINESS GROUP
    3. Title: FAMILY READINESS GROUP
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG88: DOCUMENTS
    2. File: READINESS GROUP
    3. No title
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG88: PAGES
    2. File: 74TH PEARL HARBOR DAY CEREMONY HONORS FALLEN HEROES
    3. Title: 74TH PEARL HARBOR DAY CEREMONY HONORS FALLEN HEROES
    4. Description: PEARL HARBOR - USS PREBLE (DDG 88) CONDUCTS A PASS-IN REVIEW AS PART OF THE 74TH NATIONAL PEARL HARBOR REMEMBRANCE DAY COMMEMORATION AT JOINT BASE PEARL HARBOR-HICKAM, HAWAII.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: 74TH PEARL HARBOR DAY CEREMONY HONORS FALLEN HEROES
    3. Title: 74TH PEARL HARBOR DAY CEREMONY HONORS FALLEN HEROES
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: AUSSIESHIPCOMMANDSSURFACEACTIONGROUPINPACIFICBOND
    3. Title: AUSSIE SHIP COMMANDS SURFACE ACTION GROUP IN PACIFIC BOND
    4. Description: HMAS SYDNEY, AT SEA - THE AUSTRALIAN GUIDED MISSILE FRIGATE HMAS SYDNEY TOOK COMMAND OF A SURFACE ACTION GROUP (SAG) TO INCLUDE USS PREBLE (DDG 88) DURING TRI-LATERAL NAVAL EXERCISES IN THE WESTERN PACIFIC OCEAN OFF THE MARIANAS ISLAND CHAIN.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: AUSSIESHIPCOMMANDSSURFACEACTIONGROUPINPACIFICBOND
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO1 18DECEMBER2014 22APRIL2016
    3. Title: (DECEMBER 18, 2014 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO1 18DECEMBER2014 22APRIL2016
    3. Title: CDR JEFFREY HEAMES
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO1 23APRIL2015 28SEPTEMBER2017
    3. Title: CDR JOHN A. BOWMAN
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO1 23APRIL2015 28SEPTEMBER2017
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO1 23APRIL2016 4DECEMBER2018
    3. Title: CDR ALLEN L. MAXWELL, JR.
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO1 23APRIL2016 4DECEMBER2018
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO1 FEB2013 DEC2014
    3. Title: CDR ROBERT T. BRYANS
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO1 FEB2013 DEC2014
    3. Title: CDR ROBERT T. BRYANS
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO1 JANUARY2012 RELIEVED CDRCAHILL
    3. Title: CDR JOE CAHILL
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO1 JANUARY2012 RELIEVED CDRCAHILL
    3. Title: CDR JOE CAHILL
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO1 RELIEVED 19JANUARY12 28JUNE13
    3. Title: CDR KURT M. SELLERBERG
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO1 RELIEVED 19JANUARY12 28JUNE13
    3. Title: CDR KURT M. SELLERBERG
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO1
    3. Title: (DECEMBER 5, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO1
    3. Title: COMMANDER GIOVANNELLI
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO2 10JUNE2017 15OCTOBER2018
    3. Title: COMMANDER LEONARDO GIOVANNELLI
    4. Description: COMMANDER LEONARDO GIOVANNELLI
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO2 10JUNE2017 15OCTOBER2018
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO2 12DECEMBER2014 31MARCH2016
    3. Title: CDR JOHN A. BOWMAN
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO2 12DECEMBER2014 31MARCH2016
    3. Title: EXECUTIVE OFFICER (DECEMBER 18, 2014 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO2 1APR2016 9JUN2017
    3. Title: (APRIL 1, 2016- PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO2 1APR2016 9JUN2017
    3. Title: CDR ALLEN L. MAXWELL, JR.
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO2 FEB2013 DEC2014
    3. Title: CDR JEFFREY L. HEAMES
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO2 FEB2013 DEC2014
    3. Title: CDR JEFFREY L. HEAMES
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO2 DEC2011 RELIEVED XOSELLERBERG
    3. Title: CDR KURT SELLERBERG
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO2 DEC2011 RELIEVED XOSELLERBERG
    3. Title: CDR KURT SELLERBERG
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO2 RELIEVED 6DECEMBER11 28JUNE13
    3. Title: CDR ROBERT T. BRYANS JR
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO2 RELIEVED 6DECEMBER11 28JUNE13
    3. Title: CDR ROBERT T. BRYANS JR
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO2
    3. Title: COMMANDER PETER LESACA
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO2
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO3 16MAR2013 25JUN2015
    3. Title: CMDCM(SW/AW) MATTHEW LOGSDON
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO3 16MAR2013 25JUN2015
    3. Title: CMDCM(SW/AW) MATTHEW LOGSDON
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO3 4NOVEMBER2017 22MARCH2019
    3. Title: CMDCM (SW) QUENTIN T. NEWSOM
    4. Description: COMMAND MASTER CHIEF
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO3 4NOVEMBER2017 22MARCH2019
    3. Title: NOVEMBER 3, 2017 - PRESENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO3 6JUNE2015 3NOVEMBER2017
    3. Title: CMDCM (SW/AW) TODD KUNZWEILER
    4. Description: COMMAND MASTER CHIEF
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO3 6JUNE2015 3NOVEMBER2017
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO3 JUL2010 MAR2013
    3. Title: CMDCM JEFFERY A. CAMPBELL
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO3 JUL2010 MAR2013
    3. Title: CMDCM JEFFERY A. CAMPBELL
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO3
    3. Title: CMDCM (SW/AW) FRANKLIN E. DOMINGUEZ JR.
    4. Description: COMMAND MASTER CHIEF
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BIO3
    3. Title: MARCH 23, 2019 - PRESENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BY MASS COMMUNICATION SPECIALIST 2ND CLASS JEFF TROUTMAN
    3. Title: USS PREBLE SAILOR PITCHES IDEA FOR THE BRIDGE
    4. Description: THE BRIDGE, A PROGRAM INITIATED BY U.S. PACIFIC FLEET, HOSTED AN OPEN FORUM EVENT MARCH 11 FOR ATTENDEES TO PITCH THOUGHT-PROVOKING AND INNOVATIVE IDEAS FOR IMPROVING STANDARDS AND PRACTICES WITHIN THE NAVY.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: BY MASS COMMUNICATION SPECIALIST 2ND CLASS JEFF TROUTMAN
    3. Title: USS PREBLE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: FAMILY
    3. Title: FAMILY - USS PREBLE
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: NAVY IN HAWAII MAKES STRIDES TOWARD ENERGY SECURITY IN 2015
    3. Title: NAVY IN HAWAII MAKES STRIDES TOWARD ENERGY SECURITY IN 2015
    4. Description: PEARL HARBOR -- USING INNOVATION, INGENUITY AND INCENTIVIZED STRATEGIES, NAVY REGION HAWAII AND ITS PARTNERS ARE ACHIEVING GREATER ENERGY EFFICIENCY. THE LATEST MILESTONE WILL BE RECOGNIZED DEC. 15, AS USS PREBLE WINS AN ENERGY CONSERVATION AWARD.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: NAVY IN HAWAII MAKES STRIDES TOWARD ENERGY SECURITY IN 2015
    3. Title: USS PREBLE (DDG 88)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: NEWS ARCHIVES
    3. Title: NEWS ARCHIVE
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: OMBUDSMAN
    3. Title: OMBUDSMAN - USS PREBLE
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: OURSHIP
    3. No title
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: PASTLEADERSHIP
    3. Title: PAST LEADERSHIP
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: PREBLE ARRIVES IN FREEMANTLE
    3. Title: PREBLE ARRIVES IN FREEMANTLE
    4. Description: FREMANTLE, AUSTRALIA (NNS) – THE GUIDED-MISSILE DESTROYER USS PREBLE (DDG 88), ARRIVED IN FREEMANTLE, AUSTRALIA, FOR A SCHEDULED PORT VISIT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: PREBLE ARRIVES IN FREEMANTLE
    3. Title: PREBLE ARRIVES IN FREEMANTLE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: PREBLE COMPLETES COOPERATIVE DEPLOYMENT WITH HMAS MELBOURNE
    3. Title: PREBLE COMPLETES COOPERATIVE DEPLOYMENT WITH HMAS MELBOURNE
    4. Description: THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS PREBLE (DDG 88), COMPLETED A COOPERATIVE DEPLOYMENT WITH THE ROYAL AUSTRALIAN NAVY ADELAIDE-CLASS GUIDED-MISSILE FRIGATE HMAS MELBOURNE (FFG 05) IN THE PHILIPPINE SEA ON FRIDAY, APRIL 19.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: PREBLE COMPLETES COOPERATIVE DEPLOYMENT WITH HMAS MELBOURNE
    3. Title: DDG88
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: PREBLE FITZGERALD ENJOY AUSTRALIAN CULTURE IN DARWIN
    3. Title: PREBLE, FITZGERALD ENJOY AUSTRALIAN CULTURE IN DARWIN
    4. Description: DARWIN, AUSTRALIA - CMDR. JEFFREY HEAMES (CENTER), COMMANDING OFFICER OF USS PREBLE (DDG 88), PROVIDES GUIDANCE TO THE SHIP’S BRIDGE TEAM AS THE SHIP PULLS INTO PORT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: PREBLE FITZGERALD ENJOY AUSTRALIAN CULTURE IN DARWIN
    3. Title: PREBLE, FITZGERALD ENJOY AUSTRALIAN CULTURE IN DARWIN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: PREBLE LEGACY SUSTAINED FORWARD PRESENCE
    3. Title: PREBLE LEGACY SUSTAINED FORWARD PRESENCE
    4. Description: USS PREBLE (DDG 88) IS ONE OF OUR HAWAII-BASED WARSHIPS NOW FORWARD DEPLOYED TO THE INDO-PACIFIC. LIKE OUR OTHER SURFACE WARSHIPS HOMEPORTED IN PEARL HARBOR, SAILORS ABOARD PREBLE DEMONSTRATE INTEGRITY, ACCOUNTABILITY, INITIATIVE AND TOUGHNESS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: PREBLE LEGACY SUSTAINED FORWARD PRESENCE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: PREBLE PROTECTS THE SKIES OVER TALISMAN SABRE
    3. Title: PREBLE PROTECTS THE SKIES OVER TALISMAN SABRE
    4. Description: INDIAN OCEAN - SAILORS ASSIGNED TO THE USS PREBLE (DDG 88) SALUTE REAR ADM. HUGH D. WETHERALD, COMMANDER, AMPHIBIOUS FORCE SEVENTH FLEET, AS HE PREPARES TO DEPART THE SHIP IN A HELICOPTER.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: PREBLE PROTECTS THE SKIES OVER TALISMAN SABRE
    3. Title: PREBLE PROTECTS THE SKIES OVER TALISMAN SABRE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: PREBLESAILORHONOREDASCHICAGOWHITESOXHEROOFTHEGAME
    3. Title: HERO OF THE GAME
    4. Description: A SAILOR ASSIGNED TO THE GUIDED MISSILE DESTROYER USS PREBLE (DDG 88) WAS HONORED AS THE CHICAGO WHITE SOX “HERO OF THE GAME” DURING THE TEAM’S HOME GAME AGAINST THE SAN DIEGO PADRES AT U.S. CELLULAR FIELD.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: PREBLESAILORHONOREDASCHICAGOWHITESOXHEROOFTHEGAME
    3. Title: PREBLE SAILOR HONORED AS CHICAGO WHITE SOX HERO OF THE GAME
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: REPLENISHMENTFORUSSPREBLE
    3. Title: REPLENISHMENT FOR USS PREBLE (DDG 88)
    4. Description: PACIFIC OCEAN, (OCT. 31, 2010) - USS PREBLE (DDG 88) SIMULTANEOUSLY RECEIVES FUEL AND STORES DURING A CONNECTED REPLENISHMENT (CONREP).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: REPLENISHMENTFORUSSPREBLE
    3. Title: REPLENISHMENT FOR USS PREBLE (DDG 88)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: SOY16
    3. Title: 2016 SOY FINALIST (SEA) - IC1(SW) BRENT T. SCHERMERHORN
    4. Description: USS PREBLE (DDG 88)
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: SOY16
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: SAILORS RENOVATE WILDLIFE RESERVE
    3. Title: SAILORS RENOVATE WILDLIFE RESERVE
    4. Description: FREEMANTLE, AUSTRALIA - YEOMAN 2ND CLASS THOMAS BEASLEY, ASSIGNED TO THE USS BONHOMME RICHARD (LHD 6), CARES FOR AN ORPHANED BABY KANGAROO AT THE NATIVE ARC WILDLIFE REHABILITATION CENTER.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: SAILORS RENOVATE WILDLIFE RESERVE
    3. Title: SAILORS RENOVATE WILDLIFE RESERVE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: SAILORS RECEIVE INVALUABLE TRAINING DURING TALISMAN SABRE 2015
    3. Title: SAILORS RECEIVE INVALUABLE TRAINING DURING TALISMAN SABRE 2015
    4. Description: INDIAN OCEAN - SAILORS ABOARD USS GREEN BAY (LPD 20) FLY THE BATTLE ENSIGN AS USS PREBLE (DDG 88) AND USS ASHLAND (LSD 48) SAIL ALONGSIDE.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: SAILORS RECEIVE INVALUABLE TRAINING DURING TALISMAN SABRE 2015
    3. Title: SAILORS RECEIVE INVALUABLE TRAINING DURING TALISMAN SABRE 2015
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: TRILATERALPACIFICBONDEXERCISEKICKSOFF
    3. Title: TRILATERAL PACIFIC BOND EXERCISE KICKS OFF
    4. Description: PACIFIC OCEAN - CAPT. PAUL LYONS (RIGHT), COMMANDER DESTROYER SQUADRON (DESRON) 15, TALKS WITH JAPAN MARITIME SELF-DEFENSE FORCE LT. MASAAKI MIZUNUMA ON THE PORT SIDE BRIDGE-WING ABOARD THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS PREBLE (DDG 88) DURING A MANEUVERING EXERCISE.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: TRILATERALPACIFICBONDEXERCISEKICKSOFF
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USAUSTRALIANNAVIESCONDUCTASWEXERCISESDURINGTS13
    3. Title: A ROUND IS FIRED FROM A MK-45 5 INCH GUN DURING A LIVE-FIRE WEAPONS SHOOT ABOARD USS PREBLE (DDG 88)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USAUSTRALIANNAVIESCONDUCTASWEXERCISESDURINGTS13
    3. Title: US, AUSTRALIAN NAVIES CONDUCT ASW EXERCISES DURING TS13
    4. Description: CORAL SEA – U.S. AND ROYAL AUSTRALIAN NAVY (RAN) SAILORS BEGAN A SERIES OF ANTI-SUBMARINE WARFARE (ASW) EXERCISES OFF THE NORTHEAST COAST OF AUSTRALIA IN SUPPORT OF TALISMAN SABER 2013 (TS 13).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USS PREBLE CO PRESENTED INNOVATION LEADERSHIP AWARD
    3. Title: USS PREBLE CO PRESENTED INNOVATION LEADERSHIP AWARD
    4. Description: ADM. SCOTT SWIFT, COMMANDER OF U.S. PACIFIC FLEET, PRESENTED CMDR. JEFFERY HEAMES, COMMANDING OFFICER OF USS PREBLE, THE 2015 SECNAV INNOVATION AWARD FOR THE INNOVATION LEADERSHIP.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USS PREBLE CO PRESENTED INNOVATION LEADERSHIP AWARD
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USS PREBLE CO WINS SECNAV INNOVATION LEADERSHIP AWARD
    3. Title: USS PREBLE CO WINS SECNAV INNOVATION LEADERSHIP AWARD
    4. Description: CMDR. JEFFERY HEAMES, COMMANDING OFFICER OF ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS PREBLE (DDG 88), HOMEPORTED IN PEARL HARBOR, WAS RECOGNIZED AS THE WINNER OF 2015'S SECNAV INNOVATION AWARDS PROGRAM'S INNOVATION LEADERSHIP CATEGORY, FEB. 8.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USS PREBLE CO WINS SECNAV INNOVATION LEADERSHIP AWARD
    3. Title: USS PREBLE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USS PREBLE DEPARTS FOR WESTERN PACIFIC DEPLOYMENT
    3. Title: USS PREBLE DEPARTS FOR WESTERN PACIFIC DEPLOYMENT
    4. Description: SAN DIEGO - THE ARLEIGH BURKE-CLASS GUIDED MISSILE DESTROYER USS PREBLE (DDG 88) IS SCHEDULED TO DEPART APRIL 19 FOR DEPLOYMENT TO THE 7TH FLEET AREA OF OPERATIONS (AOR).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USS PREBLE DEPARTS FOR WESTERN PACIFIC DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USS PREBLE RESPONDS TO DISTRESS CALL FROM IRANIAN VESSEL
    3. Title: USS PREBLE RESPONDS TO DISTRESS CALL FROM IRANIAN VESSEL
    4. Description: THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS PREBLE (DDG 88) RENDERED AID TO A STRANDED IRANIAN FISHING VESSEL, DEC. 16 AT APPROXIMATELY 1:00 P.M. LOCAL TIME WHILE TRANSITING THE U.S. 5TH FLEET AREA OF OPERATIONS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USS PREBLE RESPONDS TO DISTRESS CALL FROM IRANIAN VESSEL
    3. Title: DDG88
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USS PREBLE SAILORS CONDUCT COMMUNITY OUTREACH IN GUAM
    3. Title: USS PREBLE SAILORS CONDUCT COMMUNITY OUTREACH IN GUAM
    4. Description: SAILORS ASSIGNED TO THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS PREBLE (DDG 88) PARTICIPATED IN A COMMUNITY RELATIONS PROJECT AT MARCIAL A. SABLAN ELEMENTARY SCHOOL IN AGAT, GUAM, NOV.1.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USS PREBLE SAILORS CONDUCT COMMUNITY OUTREACH IN GUAM
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USS PREBLE SAILORS CONDUCT VISIT BOARD SEARCH AND SEIZURE EXERCISE
    3. Title: USS PREBLE SAILORS CONDUCT VISIT BOARD SEARCH AND SEIZURE EXERCISE
    4. Description: PACIFIC OCEAN (NNS) -- MORE THAN 20 SAILORS ABOARD ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS PREBLE (DDG 88) CONDUCTED A VISIT, BOARD, SEARCH AND SEIZURE EXERCISE, AUG. 3, OFF THE COAST OF SOUTHERN CALIFORNIA.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USS PREBLE SAILORS CONDUCT VISIT BOARD SEARCH AND SEIZURE EXERCISE
    3. Title: DDG88
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USS PREBLE RETURNS HOME FROM INDO PACIFIC DEPLOYMENT
    3. Title: USS PREBLE RETURNS HOME FROM INDO-PACIFIC DEPLOYMENT
    4. Description: THE GUIDED-MISSILE DESTROYER USS PREBLE (DDG 88), ALONG WITH THE “EASYRIDERS” OF HELICOPTER MARITIME STRIKE SQUADRON (HSM) 37, DET. 1, RETURNED TO JOINT BASE PEARL HARBOR-HICKAM, JUNE 13, FOLLOWING A DEPLOYMENT TO THE U.S. 7TH FLEET AREA OF OPERATIONS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USS PREBLE RETURNS HOME FROM INDO PACIFIC DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USS PREBLE RETURNS HOME FROM DEPLOYMENT
    3. Title: USS PREBLE RETURNS HOME FROM DEPLOYMENT
    4. Description: PEARL HARBOR - THE GUIDED-MISSILE DESTROYER USS PREBLE (DDG 88) RETURNS TO ITS HOMEPORT, JOINT BASE PEARL HARBOR-HICKAM, APRIL 27, AFTER MORE THAN SIX MONTHS ON A DEPLOYMENT TO THE U.S. 5TH AND 7TH FLEET AREAS OF OPERATION.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USS PREBLE RETURNS HOME FROM DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USS PREBLE TO RETURN FROM INDEPENDENT DEPLOYMENT
    3. Title: USS PREBLE TO RETURN FROM INDEPENDENT DEPLOYMENT
    4. Description: JOINT BASE PEARL HARBOR-HICKAM - USS PREBLE (DDG 88) IS SCHEDULED TO RETURN FROM AN INDEPENDENT DEPLOYMENT TO THE WESTERN PACIFIC OCEAN.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USS PREBLE TO RETURN FROM INDEPENDENT DEPLOYMENT
    3. Title: USS PREBLE TO RETURN FROM INDEPENDENT DEPLOYMENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USS PREBLE WINS RIMPAC 2018 BASKETBALL TOURNAMENT
    3. Title: USS PREBLE WINS RIMPAC 2018 BASKETBALL TOURNAMENT
    4. Description: SAILORS FROM GUIDED-MISSILE DESTROYER USS PREBLE (DDG 88) WON THE RIM OF THE PACIFIC (RIMPAC) BASKETBALL TOURNAMENT FINALS WITH A SCORE OF 54 TO 43 AT JOINT BASE PEARL HARBOR-HICKAM.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USS PREBLE WINS RIMPAC 2018 BASKETBALL TOURNAMENT
    3. Title: USS PREBLE WINS RIMPAC 2018 BASKETBALL TOURNAMENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLE(DDG88)CONDUCTSABURIALATSEACEREMONYFOR12VETERANS
    3. Title: BURIAL AT SEA CEREMONY WHILE UNDERWAY OFF THE COAST OF SAN DIEGO IN THE SOUTHERN CALIFORNIA
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLE(DDG88)CONDUCTSABURIALATSEACEREMONYFOR12VETERANS
    3. Title: USS PREBLE (DDG 88) CONDUCTS A BURIAL AT SEA CEREMONY FOR 12 VETERANS
    4. Description: SAN DIEGO, CALIFORNIA - USS PREBLE (DDG 88) CONDUCTED A BURIAL AT SEA CEREMONY WHILE UNDERWAY OFF THE COAST OF SAN DIEGO IN THE SOUTHERN CALIFORNIA OPERATIONAL AREA.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLE(DDG88)HOLDSCHANGEOFCOMMANDCEREMONY
    3. Title: USS PREBLE (DDG 88) HOLDS CHANGE OF COMMAND CEREMONY
    4. Description: SAN DIEGO, CALIFORNIA - USS PREBLE (DDG 88) HELD A CHANGE OF COMMAND CEREMONY UNDER THE HULL OF THE SHIP IN DRY DOCK AT BAE SHIPYARD IN SAN DIEGO, CALIFORNIA ON JANUARY 19.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLE(DDG88)HOLDSCHANGEOFCOMMANDCEREMONY
    3. Title: USS PREBLE (DDG88)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEDDG88CONDUCTSABURIALATSEACEREMONYFOR10VETERANS
    3. Title: USS PREBLE (DDG 88) CONDUCTS A BURIAL AT SEA CEREMONY FOR 10 VETERANS
    4. Description: SAN DIEGO, CALIFORNIA — USS PREBLE (DDG 88) CONDUCTED A BURIAL AT SEA CEREMONY WHILE UNDERWAY OFF THE COAST OF SAN DIEGO IN THE SOUTHERN CALIFORNIA OPERATIONAL AREA.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEDDG88CONDUCTSABURIALATSEACEREMONYFOR10VETERANS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLESURFSINTOHAWAIIFORHERFIRSTPORTVISITOF2013
    3. Title: REENLISTMENT CEREMONY ONBOARD USS ARIZONA MEMORIAL
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLESURFSINTOHAWAIIFORHERFIRSTPORTVISITOF2013
    3. Title: USS PREBLE (DDG 88) SURFS INTO HAWAII FOR HER FIRST PORT VISIT OF 2013
    4. Description: PEARL HARBOR, HAWAII – THE GUIDED MISSILE DESTROYER USS PREBLE (DDG 88) ARRIVED IN PEARL HARBOR APRIL 25 FOR THE FIRST PORT VISIT OF HER 2013 DEPLOYMENT TO THE 7TH FLEET AREA OF OPERATIONS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEVISITSBUSANREPUBLICOFKOREAFORHERFIRSTINTERNATIONALPORTVISITOF2013
    3. Title: USS PREBLE (DDG 88) VISITS BUSAN, REPUBLIC OF KOREA FOR HER FIRST INTERNATIONAL PORT VISIT OF 2013
    4. Description: BUSAN, REPUBLIC OF KOREA – THE GUIDED MISSILE DESTROYER USS PREBLE (DDG 88) ARRIVED IN BUSAN, ROK, MAY 11 FOR HER FIRST INTERNATIONAL PORT VISIT OF HER 2013 DEPLOYMENT TO THE 7TH FLEET AREA OF OPERATIONS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEVISITSBUSANREPUBLICOFKOREAFORHERFIRSTINTERNATIONALPORTVISITOF2013
    3. Title: USS PREBLE (DDG 88) VISITS BUSAN, REPUBLIC OF KOREA FOR HER FIRST INTERNATIONAL PORT VISIT OF 2013
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLE(DDG88)LAUNCHESATOMAHAWKMISSILE
    3. Title: USS PREBLE CONDUCTS TOMAHAWK OPERATIONAL TEST LAUNCHES
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLE(DDG88)LAUNCHESATOMAHAWKMISSILE
    3. Title: USS PREBLE (DDG 88) LAUNCHES A TOMAHAWK MISSILE
    4. Description: SAN DIEGO - USS PREBLE (DDG 88) CONDUCTED THREE TOMAHAWK OPERATIONAL TEST LAUNCHES (OTLS) OFF THE COAST OF SOUTHERN CALIFORNIA, SEPT. 28, 29 AND 30.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEARRIVESINBRUNEIFORAPORTVISIT
    3. Title: SAILORS FROM USS PREBLE (DDG 88) MOVE PALLETS OF SUPPLIES DURING AT SEA REPLENISHMENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEARRIVESINBRUNEIFORAPORTVISIT
    3. Title: USS PREBLE ARRIVES IN BRUNEI FOR A PORT VISIT
    4. Description: THE SAN DIEGO BASED GUIDED-MISSILE CRUISER USS PREBLE (DDG 88) ARRIVED IN BRUNEI TO TAKE PART IN THE BRUNEI INTERNATIONAL DEFENSE EXHIBITION (BRIDEX)
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLECOMPLETESWESTERNPACIFICDEPLOYMENT
    3. Title: USS PREBLE (DDG 88) HOMECOMING NOVEMBER 2013
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLECOMPLETESWESTERNPACIFICDEPLOYMENT
    3. Title: USS PREBLE COMPLETES WESTERN PACIFIC DEPLOYMENT
    4. Description: CORONADO, CALIF. - THE ARLEIGH BURKE-CLASS GUIDED, MISSILE DESTROYER USS PREBLE (DDG 88) RETURNS TO HER HOMEPORT OF SAN DIEGO, NOV. 18, AFTER COMPLETING A SEVEN-MONTH DEPLOYMENT TO THE U.S. 7TH FLEET AREA OF RESPONSIBILITY.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLECONDUCTSFISHERIESPATROL
    3. Title: SAILORS ON BOARD USS PREBLE (DDG 88) MAKE FINAL PREPARATIONS BEFORE TAKE-OFF OF AN SH-60B HELICOPTER
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLECONDUCTSFISHERIESPATROL
    3. Title: USS PREBLE CONDUCTS FISHERIES PATROL
    4. Description: PACIFIC OCEAN (MARCH 3, 2011) - SAILORS ON BOARD USS PREBLE (DDG 88) MAKE FINAL PREPARATIONS BEFORE TAKE-OFF OF AN SH-60B HELICOPTER.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLECONTRIBUTESTOHUMANITARIANEFFORTSINJAPAN
    3. Title: AN HH-60H SEA HAWK HELICOPTER LIFTS OFF FROM THE GUIDED-MISSILE DESTROYER USS PREBLE (DDG 88) AFTER REFUELING.
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLECONTRIBUTESTOHUMANITARIANEFFORTSINJAPAN
    3. Title: USS PREBLE CONTRIBUTES TO HUMANITARIAN EFFORTS IN JAPAN
    4. Description: PACIFIC OCEAN (MARCH 13, 2011) AN HH-60H SEA HAWK HELICOPTER LIFTS OFF FROM THE GUIDED-MISSILE DESTROYER USS PREBLE (DDG 88) AFTER REFUELING. THE HELICOPTER IS CONDUCTING A SEARCH OF DEBRIS FIELDS IN THE WATERS NEAR SENDAI, JAPAN.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEDDG88HOLDSCHANGEOFCOMMANDCEREMONY
    3. Title: USS PREBLE (DDG 88) HOLDS CHANGE OF COMMAND CEREMONY
    4. Description: SAN DIEGO, CALIFORNIA - USS PREBLE (DDG 88) HELD A CHANGE OF COMMAND CEREMONY WHILE IN PORT GUAM.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEDDG88HOLDSCHANGEOFCOMMANDCEREMONY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEDDG88HOSTS170MIDSHIPMENFORSUMMERTRAINING
    3. Title: USS PREBLE (DDG 88) HOSTS 170 MIDSHIPMEN FOR SUMMER TRAINING
    4. Description: SAN DIEGO — USS PREBLE (DDG 88) HOSTED 170 MIDSHIPMEN FROM AROUND THE COUNTRY FOR TRAINING FROM MAY THROUGH AUGUST 2012.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEDDG88HOSTS170MIDSHIPMENFORSUMMERTRAINING
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEDDG88HOSTSMIDSHIPMENFORSUMMERTRAINING
    3. Title: USS PREBLE (DDG 88) HOSTS MIDSHIPMEN FOR SUMMER TRAINING
    4. Description: WESTERN PACIFIC OCEAN - THE OFFICERS AND CREW OF USS PREBLE (DDG 88) HOSTED A GROUP OF 15 MIDSHIPMEN FROM AROUND THE COUNTRY FOR 10 ACTION PACKED DAYS OF TRAINING DURING THE MONTH OF AUGUST.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEDDG88HOSTSMIDSHIPMENFORSUMMERTRAINING
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEHOMECOMING
    3. Title: USS PREBLE (DDG 88)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEHOMECOMING
    3. Title: USS PREBLE (DDG88) HOMECOMING
    4. Description: THE USS PREBLE (DDG88), PART OF CARRIER STRIKE GROUP (CSG) 7 RETURNED TO SAN DIEGO SEPT. 9 AFTER A SEVEN-MONTH DEPLOYMENT TO THE WESTERN PACIFIC AND U.S. CENTRAL COMMAND AREA OF RESPONSIBILITY (AOR).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEHOSTSSCIENTISTSTOSEA
    3. Title: USS PREBLE HOSTS SCIENTISTS AT SEA
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEHOSTSSCIENTISTSTOSEA
    3. Title: USS PREBLE HOSTS SCIENTISTS TO SEA
    4. Description: USS PREBLE COMMANDING OFFICER, CDR KURT SELLERBERG, POSES ON THE BRIDGE WING WITH NINE SCIENTISTS TO SEA DURING THEIR EMBARKED VISIT ON 8-9 JANUARY, 2013. HAILING FROM SPAWAR, CHINA LAKE, AND CORONA, THESE PROFESSIONALS ARE THE INDUSTRY LINK BETWEEN THE NAVY AND HER OPERATIONAL EQUIPMENT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEPROVIDINGPROTECTION
    3. Title: USS PREBLE (DDG 88) PROVIDING PROTECTION
    4. Description: PACIFIC OCEAN (NOV. 01, 2010) - THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS PREBLE (DDG 88) PROVIDES PROTECTION FOR THE AIRCRAFT CARRIER USS RONALD REAGAN (CVN 76) DURING A SIMULATED STRAITS TRANSIT EXERCISE.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEPROVIDINGPROTECTION
    3. Title: USS PREBLE (DDG 88) PROVIDING PROTECTION
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLESAILORSEARNWEAPONQUALIFICATIONS
    3. Title: USS PREBLE (DDG88)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLESAILORSEARNWEAPONQUALIFICATIONS
    3. Title: USS PREBLE SAILORS EARN WEAPON QUALIFICATIONS
    4. Description: SAN DIEGO - SAILORS ASSIGNED TO THE GUIDED-MISSILE DESTROYER USS PREBLE (DDG 88) CONDUCTED SMALL ARMS QUALIFICATION TRAINING AT THE NAVAL AIR STATION NORTH ISLAND SMALL ARMS RANGE.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLESAILORSVISITCHILDRENSHOSPITAL
    3. Title: USS PREBLE SAILORS VISIT CHILDRENS HOSPITAL
    4. Description: SYDNEY, AUSTRALIA (JULY 31, 2013) - SAILORS ASSIGNED TO THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS PREBLE (DDG 88) VISIT A PATIENT AT THE ROYAL ALEXANDRA HOSPITAL FOR CHILDREN DURING A COMMUNITY SERVICE EVENT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLESAILORSVISITCHILDRENSHOSPITAL
    3. Title: USS PREBLE SAILORS VISIT CHILDRENS HOSPITAL
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEDISPLAYHOLIDAYLIGHTS
    3. Title: USS PREBLE DISPLAYS HOLIDAY LIGHTS
    4. Description: SAN DIEGO - THE GUIDED-MISSILE DESTROYER USS PREBLE (DDG 88) DISPLAYS HOLIDAY LIGHTING WHILE MOORED AT NAVAL BASE SAN DIEGO.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEDISPLAYHOLIDAYLIGHTS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEEMBARK
    3. Title: MIDSHIPMEN FROM THE U. S. NAVAL ACADEMY ARRIVE ON BOARD USS PREBLE (DDG 88) FOR AN UNDERWAY EMBARK.
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLEEMBARK
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLETODEPARTONWESTERNPACIFICDEPLOYMENT
    3. Title: USS PREBLE TO DEPART ON WESTERN PACIFIC DEPLOYMENT
    4. Description: PEARL HARBOR-HICKAM – THE GUIDED-MISSILE DESTROYER USS PREBLE (DDG 88) IS SCHEDULED TO DEPART ON AN INDEPENDENT DEPLOYMENT TO THE WESTERN PACIFIC OCEAN.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: USSPREBLETODEPARTONWESTERNPACIFICDEPLOYMENT
    3. Title: USS PREBLE TO DEPART ON WESTERN PACIFIC DEPLOYMENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: VICE ADM BROWN ENGAGES WITH THE FLEET TO RECEIVE FEEDBACK DISCUSS SURFACE FORCE VISION
    3. Title: VICE ADM. BROWN ENGAGES WITH THE FLEET TO RECEIVE FEEDBACK, DISCUSS SURFACE FORCE VISION
    4. Description: VICE ADM. RICHARD BROWN, COMMANDER, NAVAL SURFACE FORCES (CNSF), VISITED JOINT BASE PEARL HARBOR-HICKAM, NOV. 3-6, AS PART OF HIS WATERFRONT ENGAGEMENT SERIES.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: VICE ADM BROWN ENGAGES WITH THE FLEET TO RECEIVE FEEDBACK DISCUSS SURFACE FORCE VISION
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: WELCOME
    3. Title: WELCOME ABOARD
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: DEFAULT
    3. Title: USS PREBLE (DDG 88)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: DEFAULT
    3. Title: USS PREBLE (DDG 88)
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: NAMESAKE
    3. Title: NAMED AFTER COMMODORE EDWARD PREBLE
    4. Description: EDWARD PREBLE WAS BORN AT FALMOUTH, MAINE AND BEGAN HIS CAREER AT THE AGE OF SIXTEEN WHEN HE RAN AWAY TO SEA ON A PRIVATEER.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: OURSHIP
    3. Title: ABOUT US
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: PREBLEVISITSOREGONSTATE
    3. Title: USS PREBLE VISITS OREGON STATE NROTC
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: PREBLEVISITSOREGONSTATE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: SOYSAVESALIFE
    3. Title: SAILOR SAVED A LIFE, NAMED PREBLE SAILOR OF THE YEAR
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: SOYSAVESALIFE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: U S SHIPS ARRIVE IN BUSAN TO STRENGTHEN PARTNERSHIPS EXPERIENCE KOREAN CULTURE
    3. Title: U.S. SHIPS ARRIVE IN BUSAN TO STRENGTHEN PARTNERSHIPS, EXPERIENCE KOREAN CULTURE
    4. Description: BUSAN, REPUBLIC OF KOREA - THE GUIDED-MISSILE DESTROYER USS PREBLE (DDG 88) PULLS INTO BUSAN FOR A SCHEDULED PORT VISIT. PREBLE IS CONDUCTING ROUTINE PATROLS THROUGHOUT THE INDO-ASIA-PACIFIC REGION AS A PART OF THE U.S. 7TH FLEET.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PAGES
    2. File: U S SHIPS ARRIVE IN BUSAN TO STRENGTHEN PARTNERSHIPS EXPERIENCE KOREAN CULTURE
    3. Title: U.S. SHIPS ARRIVE IN BUSAN TO STRENGTHEN PARTNERSHIPS, EXPERIENCE KOREAN CULTURE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: PHOTOS
    2. File: 100601 N 2259P 041
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PHOTOS
    2. File: 100928 N 4281P 139
    3. Title: USS PREBLE CONDUCTS TOMAHAWK OPERATIONAL TEST LAUNCHES
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PHOTOS
    2. File: 100929 N 4281P 100
    3. Title: USS PREBLE CONDUCTS TOMAHAWK OPERATIONAL TEST LAUNCHES
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PHOTOS
    2. File: 101031 N 4819B 042
    3. Title: REPLENISHMENT FOR USS PREBLE (DDG 88)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PHOTOS
    2. File: 110303 N 9930Q 024
    3. Title: SAILORS ON BOARD USS PREBLE (DDG 88) MAKE FINAL PREPARATIONS BEFORE TAKE-OFF OF AN SH-60B HELICOPTER
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PHOTOS
    2. File: 110701 N BM466 179
    3. Title: SAILORS FROM USS PREBLE (DDG 88) MOVE PALLETS OF SUPPLIES DURING AT SEA REPLENISHMENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PHOTOS
    2. File: DSC 0689
    3. Title: BURIAL AT SEA CEREMONY WHILE UNDERWAY OFF THE COAST OF SAN DIEGO IN THE SOUTHERN CALIFORNIA
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PHOTOS
    2. File: PICTURE 118
    3. Title: USS PREBLE (DDG88)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PHOTOS
    2. File: USS PREBLE (DDG88)
    3. Title: USS PREBLE (DDG 88)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PHOTOS
    2. File: WEB 101101 N 1004S 002
    3. Title: USS PREBLE (DDG88)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PHOTOS
    2. File: WEB 110313 N 5503T 166
    3. Title: AN HH-60H SEA HAWK HELICOPTER LIFTS OFF FROM THE GUIDED-MISSILE DESTROYER USS PREBLE (DDG 88) AFTER REFUELING.
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: CDR BOWMAN 003A
    3. Title: EXECUTIVE OFFICER (DECEMBER 18, 2014 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: CDR GIOVANELLI SMALL
    3. Title: (DECEMBER 5, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: CDR GIOVANELLI
    3. Title: (DECEMBER 5, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: CMC LOGSDON SMALL
    3. Title: CMDCM(SW/AW) MATTHEW LOGSDON
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: CMDCM DOMINGUEZ SMALL
    3. Title: MARCH 23, 2019 - PRESENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: CMDCM DOMINGUEZ
    3. Title: MARCH 23, 2019 - PRESENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: CO BRYANS SMALL
    3. Title: CDR ROBERT T. BRYANS
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: CO BRYANS
    3. Title: CDR ROBERT T. BRYANS
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: DDG88 CO
    3. Title: CDR JOE CAHILL
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: DDG88 XO LCDR SELLERBERG
    3. Title: CDR KURT SELLERBERG
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: IC1 SCHERMERHORN
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: LESACA BIG
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: LESACA SMALL
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: PREBLE CMDCM CAMPBELL
    3. Title: CMDCM JEFFERY A. CAMPBELL
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: XO BRYANS SMALL
    3. Title: CDR ROBERT T. BRYANS JR
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: XO BRYANS
    3. Title: CDR ROBERT T. BRYANS JR
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: XO HEAMES SMALL
    3. Title: CDR JEFFREY L. HEAMES
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: CMC CMDCMKUNZWEILER SMALL
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: CMC CMDCMKUNZWEILER
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: CMC NEWSOM
    3. Title: NOVEMBER 3, 2017 - PRESENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: CO CDR MAXWELL SMALL
    3. Title: (APRIL 1, 2016- PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: CO CDR MAXWELL
    3. Title: (APRIL 1, 2016- PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: CO CMDRBOWMAN SMALL
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: CO CMDRBOWMAN
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: CO CMDRMAXWELL SMALL
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: CO CMDRMAXWELL
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: CO HEAMES SMALL
    3. Title: (DECEMBER 18, 2014 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: CO HEAMES
    3. Title: (DECEMBER 18, 2014 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: DDG88 CO CDR SELLERBERG
    3. Title: CDR KURT M. SELLERBERG
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: DDG88 PREBLE
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: E.PREBLE PIC
    3. Title: NAMESAKE - EDWARD PREBLE
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: PREBLE
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: XO CMDRGIOANNELLI SMALL
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: PUBLISHINGIMAGES
    2. File: XO CMDRGIOANNELLI
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: 74TH PEARL HARBOR DAY CEREMONY HONORS FALLEN HEROES
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: 74TH PEARL HARBOR DAY CEREMONY HONORS FALLEN HEROES
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: AUSSIESHIPCOMMANDSSURFACEACTIONGROUPINPACIFICBOND
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: AUSSIESHIPCOMMANDSSURFACEACTIONGROUPINPACIFICBOND
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO1 18DECEMBER2014 22APRIL2016
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO1 18DECEMBER2014 22APRIL2016
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO1 23APRIL2015 28SEPTEMBER2017
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO1 23APRIL2015 28SEPTEMBER2017
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO1 23APRIL2016 4DECEMBER2018
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO1 23APRIL2016 4DECEMBER2018
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO1 FEB2013 DEC2014
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO1 FEB2013 DEC2014
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO1 JANUARY2012 RELIEVED CDRCAHILL
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO1 JANUARY2012 RELIEVED CDRCAHILL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO1 RELIEVED 19JANUARY12 28JUNE13
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO1 RELIEVED 19JANUARY12 28JUNE13
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO1
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO1
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO2 10JUNE2017 15OCTOBER2018
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO2 10JUNE2017 15OCTOBER2018
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO2 12DECEMBER2014 31MARCH2016
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO2 12DECEMBER2014 31MARCH2016
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO2 1APR2016 9JUN2017
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO2 1APR2016 9JUN2017
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO2 FEB2013 DEC2014
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO2 FEB2013 DEC2014
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO2 DEC2011 RELIEVED XOSELLERBERG
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO2 DEC2011 RELIEVED XOSELLERBERG
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO2 RELIEVED 6DECEMBER11 28JUNE13
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO2 RELIEVED 6DECEMBER11 28JUNE13
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO2
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO2
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO3 16MAR2013 25JUN2015
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO3 16MAR2013 25JUN2015
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO3 4NOVEMBER2017 22MARCH2019
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO3 4NOVEMBER2017 22MARCH2019
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO3 6JUNE2015 3NOVEMBER2017
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO3 6JUNE2015 3NOVEMBER2017
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO3 JUL2010 MAR2013
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO3 JUL2010 MAR2013
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO3
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BIO3
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BY MASS COMMUNICATION SPECIALIST 2ND CLASS JEFF TROUTMAN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: BY MASS COMMUNICATION SPECIALIST 2ND CLASS JEFF TROUTMAN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: FAMILY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: FAMILY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: NAVY IN HAWAII MAKES STRIDES TOWARD ENERGY SECURITY IN 2015
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: NAVY IN HAWAII MAKES STRIDES TOWARD ENERGY SECURITY IN 2015
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: NEWS ARCHIVES
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: NEWS ARCHIVES
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: OMBUDSMAN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: OMBUDSMAN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: PASTLEADERSHIP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: PASTLEADERSHIP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: PREBLE ARRIVES IN FREEMANTLE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: PREBLE ARRIVES IN FREEMANTLE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: PREBLE COMPLETES COOPERATIVE DEPLOYMENT WITH HMAS MELBOURNE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: PREBLE COMPLETES COOPERATIVE DEPLOYMENT WITH HMAS MELBOURNE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: PREBLE FITZGERALD ENJOY AUSTRALIAN CULTURE IN DARWIN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: PREBLE FITZGERALD ENJOY AUSTRALIAN CULTURE IN DARWIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: PREBLE LEGACY SUSTAINED FORWARD PRESENCE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: PREBLE LEGACY SUSTAINED FORWARD PRESENCE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: PREBLE PROTECTS THE SKIES OVER TALISMAN SABRE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: PREBLE PROTECTS THE SKIES OVER TALISMAN SABRE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: PREBLESAILORHONOREDASCHICAGOWHITESOXHEROOFTHEGAME
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: PREBLESAILORHONOREDASCHICAGOWHITESOXHEROOFTHEGAME
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: REPLENISHMENTFORUSSPREBLE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: REPLENISHMENTFORUSSPREBLE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: SOY16
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: SOY16
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: SAILORS RENOVATE WILDLIFE RESERVE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: SAILORS RENOVATE WILDLIFE RESERVE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: SAILORS RECEIVE INVALUABLE TRAINING DURING TALISMAN SABRE 2015
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: SAILORS RECEIVE INVALUABLE TRAINING DURING TALISMAN SABRE 2015
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: TRILATERALPACIFICBONDEXERCISEKICKSOFF
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: TRILATERALPACIFICBONDEXERCISEKICKSOFF
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USAUSTRALIANNAVIESCONDUCTASWEXERCISESDURINGTS13
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USAUSTRALIANNAVIESCONDUCTASWEXERCISESDURINGTS13
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USS PREBLE CO PRESENTED INNOVATION LEADERSHIP AWARD
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USS PREBLE CO PRESENTED INNOVATION LEADERSHIP AWARD
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USS PREBLE CO WINS SECNAV INNOVATION LEADERSHIP AWARD
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USS PREBLE CO WINS SECNAV INNOVATION LEADERSHIP AWARD
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USS PREBLE DEPARTS FOR WESTERN PACIFIC DEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USS PREBLE DEPARTS FOR WESTERN PACIFIC DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USS PREBLE RESPONDS TO DISTRESS CALL FROM IRANIAN VESSEL
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USS PREBLE RESPONDS TO DISTRESS CALL FROM IRANIAN VESSEL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USS PREBLE SAILORS CONDUCT COMMUNITY OUTREACH IN GUAM
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USS PREBLE SAILORS CONDUCT COMMUNITY OUTREACH IN GUAM
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USS PREBLE SAILORS CONDUCT VISIT BOARD SEARCH AND SEIZURE EXERCISE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USS PREBLE SAILORS CONDUCT VISIT BOARD SEARCH AND SEIZURE EXERCISE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USS PREBLE RETURNS HOME FROM INDO PACIFIC DEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USS PREBLE RETURNS HOME FROM INDO PACIFIC DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USS PREBLE RETURNS HOME FROM DEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USS PREBLE RETURNS HOME FROM DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USS PREBLE TO RETURN FROM INDEPENDENT DEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USS PREBLE TO RETURN FROM INDEPENDENT DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USS PREBLE WINS RIMPAC 2018 BASKETBALL TOURNAMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USS PREBLE WINS RIMPAC 2018 BASKETBALL TOURNAMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLE(DDG88)CONDUCTSABURIALATSEACEREMONYFOR12VETERANS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLE(DDG88)CONDUCTSABURIALATSEACEREMONYFOR12VETERANS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLE(DDG88)HOLDSCHANGEOFCOMMANDCEREMONY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLE(DDG88)HOLDSCHANGEOFCOMMANDCEREMONY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEDDG88CONDUCTSABURIALATSEACEREMONYFOR10VETERANS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEDDG88CONDUCTSABURIALATSEACEREMONYFOR10VETERANS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLESURFSINTOHAWAIIFORHERFIRSTPORTVISITOF2013
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLESURFSINTOHAWAIIFORHERFIRSTPORTVISITOF2013
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEVISITSBUSANREPUBLICOFKOREAFORHERFIRSTINTERNATIONALPORTVISITOF2013
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEVISITSBUSANREPUBLICOFKOREAFORHERFIRSTINTERNATIONALPORTVISITOF2013
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLE(DDG88)LAUNCHESATOMAHAWKMISSILE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLE(DDG88)LAUNCHESATOMAHAWKMISSILE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEARRIVESINBRUNEIFORAPORTVISIT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEARRIVESINBRUNEIFORAPORTVISIT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLECOMPLETESWESTERNPACIFICDEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLECOMPLETESWESTERNPACIFICDEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLECONDUCTSFISHERIESPATROL
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLECONDUCTSFISHERIESPATROL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLECONTRIBUTESTOHUMANITARIANEFFORTSINJAPAN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLECONTRIBUTESTOHUMANITARIANEFFORTSINJAPAN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEDDG88HOLDSCHANGEOFCOMMANDCEREMONY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEDDG88HOLDSCHANGEOFCOMMANDCEREMONY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEDDG88HOSTS170MIDSHIPMENFORSUMMERTRAINING
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEDDG88HOSTS170MIDSHIPMENFORSUMMERTRAINING
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEDDG88HOSTSMIDSHIPMENFORSUMMERTRAINING
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEDDG88HOSTSMIDSHIPMENFORSUMMERTRAINING
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEHOMECOMING
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEHOMECOMING
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEHOSTSSCIENTISTSTOSEA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEHOSTSSCIENTISTSTOSEA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEPROVIDINGPROTECTION
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEPROVIDINGPROTECTION
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLESAILORSEARNWEAPONQUALIFICATIONS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLESAILORSEARNWEAPONQUALIFICATIONS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLESAILORSVISITCHILDRENSHOSPITAL
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLESAILORSVISITCHILDRENSHOSPITAL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEDISPLAYHOLIDAYLIGHTS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEDISPLAYHOLIDAYLIGHTS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEEMBARK
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLEEMBARK
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLETODEPARTONWESTERNPACIFICDEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: USSPREBLETODEPARTONWESTERNPACIFICDEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: VICE ADM BROWN ENGAGES WITH THE FLEET TO RECEIVE FEEDBACK DISCUSS SURFACE FORCE VISION
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: VICE ADM BROWN ENGAGES WITH THE FLEET TO RECEIVE FEEDBACK DISCUSS SURFACE FORCE VISION
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: DEFAULT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: DEFAULT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: NAMESAKE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: NAMESAKE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: PREBLEVISITSOREGONSTATE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: PREBLEVISITSOREGONSTATE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: SOYSAVESALIFE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: SOYSAVESALIFE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: U S SHIPS ARRIVE IN BUSAN TO STRENGTHEN PARTNERSHIPS EXPERIENCE KOREAN CULTURE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88: LAYOUTS: AUTHENTICATE
    2. File: U S SHIPS ARRIVE IN BUSAN TO STRENGTHEN PARTNERSHIPS EXPERIENCE KOREAN CULTURE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG88
    2. No filename (redirect)
    3. Title: USS PREBLE
    4. No description
    5. No keywords
    6. No extension (redirect)


    1. Path: SURFOR: DDG89: PAGES
    2. File: 356CPOTRAININGONUSSMUSTIN
    3. Title: 356 CPO TRAINING ON BOARD USS MUSTIN
    4. Description: PHILIPPINE SEA - CMDR. JOSEPH RING, COMMANDING OFFICER OF THE GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) SPEAKS TO 1ST CLASS PETTY OFFICERS DURING 356 CPO TRAINING.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: 356CPOTRAININGONUSSMUSTIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: ANTIETAM MUSTIN BUILD FOSTER RELATIONSHIPS IN SYDNEY
    3. Title: ANTIETAM, MUSTIN BUILD, FOSTER RELATIONSHIPS IN SYDNEY
    4. Description: SYDNEY - THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) TRANSITS THROUGH THE SYDNEY HARBOR AS SHE PREPARES TO MOOR FOR A PORT VISIT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: ANTIETAM MUSTIN BUILD FOSTER RELATIONSHIPS IN SYDNEY
    3. Title: ANTIETAM, MUSTIN BUILD, FOSTER RELATIONSHIPS IN SYDN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO1 02APR2014 05AUG2015
    3. Title: CDR JOSEPH A. TORRES JR.
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO1 02APR2014 05AUG2015
    3. Title: CDR JOSEPH A. TORRES JR.
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO1 13JUN2012 01APR2014
    3. Title: CDR JOSEPH J. RING
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO1 13JUN2012 01APR2014
    3. Title: CDR JOSEPH J. RING
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO2 16MAY2013 MAR2014
    3. Title: CDR JOSEPH A. TORRES JR.
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO2 16MAY2013 MAR2014
    3. Title: CDR JOSEPH A. TORRES JR.
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO2 MAR2014 JUL2015
    3. Title: CDR THANE C. CLARE
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO2 MAR2014 JUL2015
    3. Title: CDR THANE C. CLARE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO2 RELIEVEDAUG2012
    3. Title: LCDR COLLIN C. SULLIVAN
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO2 RELIEVEDAUG2012
    3. Title: LCDR COLLIN C. SULLIVAN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO2 SEP2012 16MAY2013
    3. Title: LCDR PETER M. BERNARD
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO2 SEP2012 16MAY2013
    3. Title: LCDR PETER M. BERNARD
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO2
    3. Title: CDR COORE
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO3
    3. Title: CMDCM TROY A. BOJORQUIZ
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: CTF70ADMIRALVISITSUSSMUSTINATSEA
    3. Title: CTF70 ADMIRAL VISITS USS MUSTIN AT SEA
    4. Description: PHILIPPINE SEA – COMMANDER, TASK FORCE 70 REAR ADM. JOHN R. HALEY VISITED GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) TO MEET WITH THE CREW AND SHOW HIS APPRECIATION FOR THEIR EFFORTS IN THE 7TH FLEET AREA OF OPERATIONS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: CTF70ADMIRALVISITSUSSMUSTINATSEA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: CAMBODIAN BORNCOMMANDERVISITSHISHOMELAND
    3. Title: CAMBODIA PORT VISIT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: CAMBODIAN BORNCOMMANDERVISITSHISHOMELAND
    3. Title: CAMBODIAN-BORN COMMANDER VISITS HIS HOMELAND
    4. Description: SIHANOUKVILLE, CAMBODIA (DEC. 3, 2010) - CMDR. MICHAEL V. MISIEWICZ, COMMANDING OFFICER OF THE GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89), GREETS MEMBERS OF HIS FAMILY AS MUSTIN ARRIVES IN SIHANOUKVILLE, CAMBODIA.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: CHANGEOFCOMMANDONBOARDUSSMUSTIN
    3. Title: CMDR. MICHAEL V. MISIEWICZ DEPARTS AS CMDR. SCOTT A. TAIT, COMMANDING OFFICER OF THE USS MUSTIN.
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: CHANGEOFCOMMANDONBOARDUSSMUSTIN
    3. Title: MUSTIN HOLDS CHANGE OF COMMAND CEREMONY
    4. Description: YOKOSUKA, JAPAN (JAN. 28, 2011) – THE ARLEIGH BURKE-CLASS GUIDED MISSILE DESTROYER USS MUSTIN (DDG 89), FORWARD-DEPLOYED TO COMMANDER FLEET ACTIVITIES YOKOSUKA, JAPAN, HELD A CHANGE OF COMMAND CEREMONY ON BOARD MUSTIN JAN. 28.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: CHRISTMASFESTIVITIESABOARDUSSMUSTIN(DDG89)
    3. Title: CHRISTMAS FESTIVITIES ABOARD USS MUSTIN (DDG89)
    4. Description: ENGINEMAN 3RD CLASS JERMALE WOODY HELPS A SAILOR FROM THE JAPAN MARITIME SELF-DEFENSE FORCE DESTROYER JDS IKAZUCHI (DD 107) PICK OUT CHRISTMAS ORNAMENTS FOR A CHRISTMAS TREE.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: CHRISTMASFESTIVITIESABOARDUSSMUSTIN(DDG89)
    3. Title: USS MUSTIN (DDG89)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: COMMANDERBATTLEFORCE7THFLEETVISITSUSSMUSTIN
    3. Title: COMMANDER, BATTLE FORCE 7TH FLEET VISITS USS MUSTIN
    4. Description: PHILIPPINE SEA - THE COMMANDER OF BATTLE FORCE 7TH FLEET VISITED THE FORWARD-DEPLOYED ARLEIGH BURKE-CLASS GUIDED MISSILE DESTROYER USS MUSTIN (DDG 89) DURING ITS 2013 FALL PATROL.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: COMMANDERBATTLEFORCE7THFLEETVISITSUSSMUSTIN
    3. Title: COMMANDER, BATTLE FORCE 7TH FLEET VISITS USS MUSTIN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: FAMILY
    3. Title: FAMILY - USS MUSTIN
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: FLIGHTOPERATIONSATSEAONUSSMUSTIN
    3. Title: FLIGHT OPERATIONS AT SEA ON USS MUSTIN
    4. Description: PHILIPPINE SEA - SAILORS ASSIGNED TO USS MUSTIN (DDG 89) CONDUCT FLIGHT OPERATIONS AT SEA WITH THE WARLORDS OF HELICOPTER ANTISUBMARINE SQUADRON LIGHT (HSL) 51.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: FLIGHTOPERATIONSATSEAONUSSMUSTIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: GENERALQUARTERSDRILLONUSSMUSTIN
    3. Title: GENERAL QUARTERS DRILL ON USS MUSTIN
    4. Description: EAST CHINA SEA - SAILORS ASSIGNED TO THE GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) PERFORM A COMMUNICATIONS CHECK IN ONE OF THE SHIP’S REPAIR LOCKERS DURING A GENERAL QUARTERS DRILL.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: GENERALQUARTERSDRILLONUSSMUSTIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: JOHNSMCCAINMUSTINJOIN75THBLACKSHIPFESTIVAL
    3. Title: CELEBRATING STRONG TIES
    4. Description: SHIMODA, JAPAN – THE GUIDED-MISSILE DESTROYERS USS JOHN S. MCCAIN (DDG 56) AND USS MUSTIN (DDG 89) ANCHORED AT SHIMODA, JOIN IN THE CITY'S 75TH ANNUAL BLACK SHIP FESTIVAL.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: JOHNSMCCAINMUSTINJOIN75THBLACKSHIPFESTIVAL
    3. Title: JOHN S. MCCAIN SAILORS
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUNISING MICHIGAN NATIVE SERVES ABOARD USS MUSTIN
    3. Title: MUNISING MICHIGAN NATIVE SERVES ABOARD USS MUSTIN
    4. Description: MARCH 13, 2018 – A MUNISING, MICHIGAN NATIVE AND 1996 MUNISING HIGH SCHOOL GRADUATE, CHIEF GUNNER’S MATE JUSTIN HOFFMAN, IS SERVING IN THE U.S. NAVY ABOARD THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) FORWARD-DEPLOYED TO YOKOSUKA JAPAN.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUNISING MICHIGAN NATIVE SERVES ABOARD USS MUSTIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTIN CHIEF EARNS COMMISSIONING TO WARRANT OFFICER
    3. Title: CHIEF PERSONNEL SPECIALIST ALBERTO MARTINEZ
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTIN CHIEF EARNS COMMISSIONING TO WARRANT OFFICER
    3. Title: MUSTIN CHIEF EARNS COMMISSIONING TO WARRANT OFFICER
    4. Description: PHILLIPINE SEA (NNS) – A CHIEF PERSONNEL SPECIALIST ABOARD THE FORWARD-DEPLOYED ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) WAS SELECTED FOR A SPECIAL COMMISSIONING TO CHIEF WARRANT OFFICER.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTIN HSM 51 NAMED 2014 SHIP HELICOPTER SAFETY AWARD WINNERS
    3. Title: MUSTIN, HSM-51 NAMED 2014 SHIP-HELICOPTER SAFETY AWARD WINNERS
    4. Description: CORAL SEA - THE FORWARD-DEPLOYED USS MUSTIN (DDG 89) AND ITS EMBARKED HELICOPTER DETACHMENT FROM THE ‘WARLORDS’ OF HELICOPTER MARITIME STRIKE SQUADRON (HSM ) 51, WERE SELECTED FOR THE ANNUAL CHIEF OF NAVAL OPERATIONS (CNO) SHIP-HELICOPTER SAFETY AWARD.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTIN HSM 51 NAMED 2014 SHIP HELICOPTER SAFETY AWARD WINNERS
    3. Title: MUSTIN, HSM-51 NAMED 2014 SHIP-HELICOPTER SAFETY AWARD WINNERS
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTIN HONORS THE PASSING OF THEIR NAMESAKE
    3. Title: MUSTIN HONORS THE PASSING OF THEIR NAMESAKE
    4. Description: YOKOSUKA, JAPAN (MAY 6, 2016) – THE CREW OF THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) HELD A MEMORIAL SERVICE FOR A MEMBER OF THE MUSTIN FAMILY
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTIN HONORS THE PASSING OF THEIR NAMESAKE
    3. Title: USS WILLIAM P. LAWRENCE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTIN SAILORS PAUSE TO REMEMBER WWII ERA USS JOHNSTON
    3. Title: MUSTIN SAILORS PAUSE TO REMEMBER WWII-ERA USS JOHNSTON
    4. Description: SAILORS ABOARD THE GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) OBSERVED A MOMENT OF SILENCE IN HONOR OF USS JOHNSTON (DD 557) AND HER CREW, HOLDING A REMEMBRANCE CEREMONY ON MUSTIN’S FLIGHT DECK, JULY 19.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTIN SAILORS PAUSE TO REMEMBER WWII ERA USS JOHNSTON
    3. Title: DDG89
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTIN,KAZUCHIRECONFIRMSISTERSHIPRELATIONSHIP
    3. Title: CO OF USS MUSTIN, CMDR. MICHAEL MISIEWICZ WELCOMES TOKIHIKO UMEZAKI, CO OF JAPAN MARITIME SELF-DEFENSE FORCE IKAZUCHI
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTIN,KAZUCHIRECONFIRMSISTERSHIPRELATIONSHIP
    3. Title: MUSTIN, IKAZUCHI RECONFIRM SISTER SHIP RELATIONSHIP
    4. Description: YOKOSUKA, JAPAN (DEC. 22, 2010) - COMMANDING OFFICER OF USS MUSTIN, CMDR. MICHAEL MISIEWICZ WELCOMES TOKIHIKO UMEZAKI, COMMANDING OFFICER OF JAPAN MARITIME SELF-DEFENSE FORCE IKAZUCHI AS HE ARRIVES ON BOARD USS MUSTIN.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINCONDUCTSVERTREPRASWITHUSNSAMELIAEARHART
    3. Title: MUSTIN CONDUCTS VERTREP, RAS WITH USNS AMELIA EARHART
    4. Description: SOUTH CHINA SEA – GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) SUCCESSFULLY COMPLETED A VERTICAL REPLENISHMENT (VERTREP) AND REPLENISHMENT AT SEA (RAS) WITH MILITARY SEALIFT FLEET REPLENISHMENT DRY CARGO SHIP, AMELIA EARHART (T-AKE 6).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINCONDUCTSVERTREPRASWITHUSNSAMELIAEARHART
    3. Title: MUSTIN CONDUCTS VERTREP, RAS WITH USNS AMELIA EARHART
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINDEPARTSDRYDOCKINYOKOSUKAJAPAN
    3. Title: MUSTIN DEPARTS DRYDOCK IN YOKOSUKA, JAPAN
    4. Description: YOKOSUKA, JAPAN –THE GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) SUCCESSFULLY FLOATED OUT FROM DRYDOCK, COMPLETING A MAJOR MILESTONE DURING ITS DRYDOCK SHIP’S RESTRICTED AVAILABILITY (DSRA),.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINDEPARTSDRYDOCKINYOKOSUKAJAPAN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINFROCKSNEARLYTWODOZENSAILORSINAT SEACEREMONY
    3. Title: MUSTIN FROCKS NEARLY TWO DOZEN SAILORS IN AT-SEA CEREMONY
    4. Description: PACIFIC OCEAN (NOV. 29, 2010) - CMDR. MICHAEL V. MISIEWICZ, COMMANDING OFFICER OF THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) MOVES INTO POSITION TO FROCK 22 NEW PETTY OFFICERS DURING AN ADVANCEMENT CEREMONY HELD ABOARD THE SHIP.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINFROCKSNEARLYTWODOZENSAILORSINAT SEACEREMONY
    3. Title: USS MUSTIN (DDG 89) FROCKS NEARLY TWO DOZEZ SAILORS IN AT-SEA CEREMONY
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINFURTHERSSUICIDEPREVENTIONAWARENESS
    3. Title: MUSTIN FURTHERS SUICIDE PREVENTION AWARENESS
    4. Description: PACIFIC OCEAN - SAILORS ASSIGNED TO GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) TOOK PART IN SUICIDE PREVENTION TRAINING ON THE SHIP’S MESS DECKS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINFURTHERSSUICIDEPREVENTIONAWARENESS
    3. Title: MUSTIN FURTHERS SUICIDE PREVENTION AWARENESS
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINHSL51DET6ENJOYTHANKSGIVINGINEASTCHINASEA
    3. Title: MUSTIN, HSL 51 DET. 6, ENJOY THANKSGIVING IN EAST CHINA SEA
    4. Description: EAST CHINA SEA – SAILORS ASSIGNED TO GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) AND THE WARLORDS OF HELICOPTER ANTI-SUBMARINE SQUADRON LIGHT (HSL) 51 DETACHMENT SIX CELEBRATED THE THANKSGIVING HOLIDAY AT SEA.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINHSL51DET6ENJOYTHANKSGIVINGINEASTCHINASEA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINHSL51DET6FROCK46NEWPETTYOFFICERS
    3. Title: MUSTIN, HSL 51 DET. 6, FROCK 46 NEW PETTY OFFICERS
    4. Description: WESTERN PACIFIC OCEAN – GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) AND THE “WARLORDS” OF HELICOPTER ANTI-SUBMARINE SQUADRON LIGHT (HSL) 51 DETACHMENT SIX, FROCKED 46 NEW PETTY OFFICERS ON THE MESS DECKS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINHSL51DET6FROCK46NEWPETTYOFFICERS
    3. Title: MUSTIN, HSL 51 DET. 6, FROCK 46 NEW PETTY OFFICERS
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINHONORNAVYBIRTHDAYWITHBELLRINGINGCAKECUTTINGCEREMONY
    3. Title: MUSTIN HONOR NAVY BIRTHDAY WITH BELL RINGING, CAKE CUTTING CEREMONY
    4. Description: YELLOW SEA – GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) HELD A CELEBRATION TO HONOR THE NAVY’S 237TH BIRTHDAY ON THE MESS DECKS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINHONORNAVYBIRTHDAYWITHBELLRINGINGCAKECUTTINGCEREMONY
    3. Title: MUSTIN HONOR NAVY BIRTHDAY WITH BELL RINGING, CAKE CUTTING CEREMONY
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINHOSTSESWSRODEO
    3. Title: MUSTIN HOSTS ESWS RODEO
    4. Description: SOUTH CHINA SEA – GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) CORRALLED SAILORS PURSUING THEIR ENLISTED SURFACE WARFARE SPECIALIST (ESWS) QUALIFICATION ON THE MESS DECKS FOR AN ESWS RODEO.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINHOSTSESWSRODEO
    3. Title: MUSTIN HOSTS ESWS RODEO
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINJOHNSMCCAINSAILORSVISITSCHOOLCHILDRENDURINGBLACKSHIPFESTIVAL
    3. Title: MUSTIN, JOHN S. MCCAIN SAILORS VISIT SCHOOL CHILDREN DURING BLACK SHIP FESTIVAL
    4. Description: SHIMODA, JAPAN (NNS) -- SAILORS ASSIGNED TO THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYERS USS MUSTIN (DDG 89) AND USS JOHN S. MCCAIN (DDG 56) PARTICIPATED IN A GOOD WILL AND CULTURAL EXCHANGE AT INASHO AND INOZAWA ELEMENTARY SCHOOLS IN SHIMODA.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINJOHNSMCCAINSAILORSVISITSCHOOLCHILDRENDURINGBLACKSHIPFESTIVAL
    3. Title: MUSTIN, JOHN S. MCCAIN SAILORS VISIT SCHOOL CHILDREN DURING BLACK SHIP FESTIVAL
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINSAILORSCELEBRATECENTENNIALOFNAVALAVIATION
    3. Title: MUSTIN SAILORS CELEBRATE CENTENNIAL OF NAVAL AVIATION
    4. Description: YOKOSUKA, JAPAN - SAILORS ABOARD THE GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) CELEBRATED 100 YEARS OF NAVAL AVIATION WITH A CEREMONY HONORING CAPT. HENRY MUSTIN, DEC. 7.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINSAILORSCELEBRATECENTENNIALOFNAVALAVIATION
    3. Title: USS MUSTIN DDG89
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINSAILORSTAKEE6ADVANCEMENTEXAMATSEA
    3. Title: MUSTIN SAILORS TAKE E-6 ADVANCEMENT EXAM AT SEA
    4. Description: PHILIPPINE SEA – APPROXIMATELY 30 SAILORS ASSIGNED TO GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) TOOK PART IN THE PETTY OFFICER 1ST CLASS NAVY-WIDE ADVANCEMENT EXAM ON THE SHIP’S MESS DECKS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINSAILORSTAKEE6ADVANCEMENTEXAMATSEA
    3. Title: MUSTIN SAILORS TAKE E-6 ADVANCEMENT EXAM AT SEA
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINSUPPORTSOPERATIONDAMAYAN
    3. Title: MUSTIN SUPPORTS OPERATION DAMAYAN
    4. Description: ORMAC CITY, REPUBLIC OF THE PHILIPPINES - U.S. NAVY SAILORS ALONG WITH THE PHILIPPINE GOVERNMENT AND NON-GOVERNMENT ORGANIZATIONS PROVIDED AID AND SUPPLIES TO 18 VILLAGES THROUGHOUT THE AREA.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINSUPPORTSOPERATIONDAMAYAN
    3. Title: MUSTIN SUPPORTS OPERATION DAMAYAN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINWELCOMESSIXNEWCPOSINTOTHEMESS
    3. Title: MUSTIN WELCOMES SIX NEW CPOS INTO THE MESS
    4. Description: PACIFIC OCEAN – GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) HELD A PINNING CEREMONY FOR SIX NEW CHIEF PETTY OFFICERS (CPO) ON THE SHIP’S FORECASTLE.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINWELCOMESSIXNEWCPOSINTOTHEMESS
    3. Title: MUSTIN WELCOMES SIX NEW CPOS INTO THE MESS
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: NAVY LEADER PASSES AWAY, LEAVES LEGACY IN SURFACE WARFARE COMMUNITY
    3. Title: NAVY LEADER PASSES AWAY, LEAVES LEGACY IN SURFACE WARFARE COMMUNITY
    4. Description: RETIRED VICE ADM. HENRY C. MUSTIN PASSED AWAY APRIL 11 FROM CONGESTIVE HEART FAILURE AT AGE 82. THE U.S. NAVAL ACADEMY IN ANNAPOLIS, MARYLAND, WILL HOLD FUNERAL SERVICES AT THE ACADEMY CHAPEL TO HONOR MUSTIN AND HIS 34-YEAR SERVICE TO THE NAVY.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: NAVY LEADER PASSES AWAY, LEAVES LEGACY IN SURFACE WARFARE COMMUNITY
    3. Title: RETIRED VICE ADM. HENRY C. MUSTIN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: NEW YORK NATIVE SERVES ABOARD USS MUSTIN
    3. Title: NEW YORK NATIVE SERVES ABOARD USS MUSTIN
    4. Description: A NEW YORK, N.Y., NATIVE AND 2008 GEORGE WASHINGTON HIGH SCHOOL GRADUATE IS SERVING IN THE U.S. NAVY ABOARD THE GUIDED-MISSILE DESTROYER, USS MUSTIN (DDG 89).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: NEW YORK NATIVE SERVES ABOARD USS MUSTIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: NEWS ARCHIVE
    3. Title: NEWS ARCHIVE
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: OURSHIP
    3. No title
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: PACIFICFLEETCOMMANDERVISITSUSSMUSTINPRAISESCREWINMALAYSIA
    3. Title: PACIFIC FLEET COMMANDER VISITS USS MUSTIN, PRAISES CREW IN MALAYSIA
    4. Description: PORT KLANG, MALAYSIA - ADM. CECIL HANEY, COMMANDER OF THE U.S. PACIFIC FLEET, VISITED USS MUSTIN (DDG 89) DURING THE SHIP'S PORT VISIT TO MALAYSIA.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: PACIFICFLEETCOMMANDERVISITSUSSMUSTINPRAISESCREWINMALAYSIA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: PASTLEADERSHIP
    3. Title: PAST LEADERSHIP
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: PHOTOS
    3. Title: PHOTOS
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: PINESVILLE NATIVE SERVES ABOARD USS MUSTIN
    3. Title: PINESVILLE NATIVE SERVES ABOARD USS MUSTIN
    4. Description: A PINESVILLE, LA. NATIVE AND 2013 PINESVILLE HIGH SCHOOL GRADUATE IS SERVING IN THE U.S. NAVY ABOARD THE GUIDED-MISSILE DESTROYER, USS MUSTIN (DDG 89).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: PINESVILLE NATIVE SERVES ABOARD USS MUSTIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: ROK CSOFEX09 3
    3. Title: USS MUSTIN TRAINS WITH REPUBLIC OF KOREA DURING CSOFEX 09-3
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: ROK CSOFEX09 3
    3. Title: USS MUSTIN TRAINS WITH REPUBLIC OF KOREA DURING CSOFEX 09-3
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: REPLENISHMENTATSEAONUSSMUSTIN
    3. Title: REPLENISHMENT AT SEA ON USS MUSTIN
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: REPLENISHMENTATSEAONUSSMUSTIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: REQUEST A SPONSOR SPLASH
    3. Title: REQUEST A SPONSOR SPLASH
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: SEVENTHFLEETTESTSINNOVATIVEMISSILEDEFENSESYSTEM
    3. Title: SEVENTH FLEET TESTS INNOVATIVE MISSILE DEFENSE SYSTEM
    4. Description: GUAM - SEVENTH FLEET AND THE NAVY WARFARE DEVELOPMENT COMMAND TESTED MARITIME OBSCURANT GENERATOR PROTOTYPES TO ASSESS THEIR TACTICAL EFFECTIVENESS FOR ANTI-SHIP MISSILE DEFENSE.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: SEVENTHFLEETTESTSINNOVATIVEMISSILEDEFENSESYSTEM
    3. Title: SEVENTH FLEET TESTS INNOVATIVE MISSILE DEFENSE SYSTEM
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: UNREP PHILLIPPINESEA
    3. Title: MUSTIN CONDUCTS UNDERWAY REPLENISHMENT
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: UNREP PHILLIPPINESEA
    3. Title: PHILIPPINE SEA - THE ARLEIGH BURKE-CLASS DESTROYER USS MUSTIN (DDG 89) CONNECTS WITH THE OILER USNS WALTER S. DIEHL (T-AO 193)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: US THAILAND CONCLUDE CARAT THAILAND 2018
    3. Title: U.S., THAILAND CONCLUDE CARAT THAILAND 2018
    4. Description: PATTAYA, THAILAND (NNS) -- THE 24TH ANNUAL COOPERATION AFLOAT READINESS AND TRAINING (CARAT) EXERCISE BETWEEN THE U.S. NAVY AND MARINE CORPS, AND ROYAL THAI NAVY CONCLUDED IN PATTAYA, THAILAND, JUNE 21.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: US THAILAND CONCLUDE CARAT THAILAND 2018
    3. Title: DDG89
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: US AND KOREAN NAVIES EMBRACE TRAINING OPPORTUNITIES DURING JANUARY BILATERAL EXCHANGE
    3. Title: U.S. AND KOREAN NAVIES EMBRACE TRAINING OPPORTUNITIES DURING JANUARY BILATERAL EXCHANGE
    4. Description: DONGHAE, REPUBLIC OF KOREA (NNS) -- THE GUIDED-MISSILE DESTROYERS USS MUSTIN (DDG 89) AND USS JOHN S. MCCAIN (DDG 56) ARE PARTICIPATING IN A BILATERAL TRAINING EXERCISE FROM WITH THEIR COUNTERPARTS IN THE REPUBLIC OF KOREA NAVY.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: US AND KOREAN NAVIES EMBRACE TRAINING OPPORTUNITIES DURING JANUARY BILATERAL EXCHANGE
    3. Title: U.S. AND KOREAN NAVIES EMBRACE TRAINING OPPORTUNITIES DURING JANUARY BILATERAL EXCHANGE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN PROCEEDING OUT TO SEA FROM YOKOSUKA NAVAL BASE JAPAN
    3. Title: USS MUSTIN PROCEEDING OUT TO SEA FROM YOKOSUKA NAVAL BASE JAPAN
    4. Description: USS MUSTIN PROCEEDING OUT TO SEA FROM YOKOSUKA NAVAL BASE, JAPAN.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN PROCEEDING OUT TO SEA FROM YOKOSUKA NAVAL BASE JAPAN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN (DDG 89) ARRIVES IN CAM RANH INTERNATIONAL PORT
    3. Title: USS MUSTIN (DDG 89) ARRIVES IN CAM RANH INTERNATIONAL PORT
    4. Description: CAM RANH INTERNATIONAL PORT, VIETNAM (NNS) – THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) ARRIVED IN CAM RANH INTERNATIONAL PORT TODAY FOR A ROUTINE TECHNICAL STOP THAT HIGHLIGHTS THE STRONG HISTORIC, COMMUNITY, AND MILITARY CONNECTIONS BETWEEN VIETNAM AND THE UNITED STATES.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN (DDG 89) ARRIVES IN CAM RANH INTERNATIONAL PORT
    3. Title: USS MUSTIN (DDG 89) ARRIVES IN CAM RANH INTERNATIONAL PORT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN ARRIVES FOR BLACK SHIP FESTIVAL
    3. Title: USS MUSTIN (DDG89)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN ARRIVES FOR BLACK SHIP FESTIVAL
    3. Title: USS MUSTIN ARRIVES FOR BLACK SHIP FESTIVAL
    4. Description: SHIMODA, JAPAN (MAY 18, 2017) THE FORWARD-DEPLOYED ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) PULLED INTO THE PORT OF SHIMODA, JAPAN, MAY 18, TO CELEBRATE THE 78TH ANNUAL BLACK SHIP FESTIVAL.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN ARRIVES FOR PORT VISIT IN GUAM DURING MULTISAIL 18
    3. Title: USS MUSTIN ARRIVES FOR PORT VISIT IN GUAM DURING MULTISAIL 18
    4. Description: APRA HARBOR, GUAM (NNS) – THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) ARRIVED IN GUAM FOR A SCHEDULED PORT VISIT MARCH 14 AFTER THE CONCLUSION OF MULTISAIL 18.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN ARRIVES FOR PORT VISIT IN GUAM DURING MULTISAIL 18
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN ARRIVES FOR PORT VISIT IN GUAM
    3. Title: USS MUSTIN ARRIVES FOR PORT VISIT IN GUAM
    4. Description: APRA HARBOR, GUAM (NNS) – THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) ARRIVED IN GUAM FOR A SCHEDULED PORT VISIT MARCH 3.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN ARRIVES FOR PORT VISIT IN GUAM
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN ARRIVES IN GUAM
    3. Title: USS MUSTIN (DDG89)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN ARRIVES IN GUAM
    3. Title: USS MUSTIN ARRIVES IN GUAM
    4. Description: APRA HARBOR, GUAM (MAR. 1, 2017) THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) ARRIVED AT NAVAL BASE GUAM FOR A ROUTINE PORT VISIT MAR. 1.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN ARRIVES IN OTARU JAPAN
    3. Title: USS MUSTIN ARRIVES IN OTARU JAPAN
    4. Description: OTARU, JAPAN (NNS) – THE FORWARD-DEPLOYED ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) ARRIVED FOR ITS THIRD PORT VISIT TO OTARU, JAPAN, FEB. 2.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN ARRIVES IN OTARU JAPAN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN CHIEF PETTY OFFICERS HOST 127TH BIRTHDAY CELEBRATION
    3. Title: USS MUSTIN CHIEF PETTY OFFICERS HOST 127TH BIRTHDAY CELEBRATION
    4. Description: ONE HUNDRED AND TWENTY SEVEN YEARS AFTER ITS ESTABLISHMENT, SAILORS ABOARD THE ARLEIGH BURKE-CLASS GUIDED MISSILE DESTROYER USS MUSTIN (DDG 89) HOSTED A CEREMONY TO HONOR AND CELEBRATE THE ESTABLISHMENT OF THE CHIEF PETTY OFFICER RANKS APRIL 1.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN CHIEF PETTY OFFICERS HOST 127TH BIRTHDAY CELEBRATION
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN CONDUCTS NAVY SURFACE FIRING SUPPORT RECERTIFICATION
    3. Title: USS MUSTIN CONDUCTS NAVY SURFACE FIRING SUPPORT RECERTIFICATION
    4. Description: THE NAVY’S FORWARD-DEPLOYED ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) COMPLETED A NAVAL SURFACE FIRE SUPPORT (NSFS) RECERTIFICATION ON NOV. 2.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN CONDUCTS NAVY SURFACE FIRING SUPPORT RECERTIFICATION
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN DDG 89 ARRIVES IN CAM RANH INTERNATIONAL PORT
    3. Title: USS-MUSTIN DDG-89-ARRIVES-IN-CAM-RANH-INTERNATIONAL-PORT
    4. Description: CAM RANH INTERNATIONAL PORT, VIETNAM (NNS) – THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) ARRIVED IN CAM RANH ...
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN DDG 89 ARRIVES IN CAM RANH INTERNATIONAL PORT
    3. Title: DDG89
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN DEPARTS SHIMODA BLACK SHIP FESTIVAL
    3. Title: USS MUSTIN DEPARTS SHIMODA, BLACK SHIP FESTIVAL
    4. Description: SHIMODA, JAPAN (MAY 23, 2017) – THE FORWARD-DEPLOYED ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) DEPARTED SHIMODA, JAPAN AFTER A PORT VISIT, MAY 18-22, DURING THE CITY’S BLACK SHIP FESTIVAL.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN DEPARTS SHIMODA BLACK SHIP FESTIVAL
    3. Title: DDG89
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN HOLDS CHANGE OF COMMAND
    3. Title: USS MUSTIN (DDG89)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN HOLDS CHANGE OF COMMAND
    3. Title: USS MUSTIN HOLDS CHANGE OF COMMAND
    4. Description: YOKOSUKA, JAPAN (FEB 24, 2017) – CMDR. WARREN D. SMITH RELIEVED CMDR. THANE C. CLARE AS COMMANDING OFFICER OF THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) DURING A CHANGE OF COMMAND CEREMONY AT COMMANDER, FLEET ACTIVITIES YOKOSUKA (CFAY), FEB. 24.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN JOINS FORCES WITH NEW ZEALAND DURING TALISMAN SABRE
    3. Title: USS MUSTIN JOINS FORCES WITH NEW ZEALAND DURING TALISMAN SABRE
    4. Description: TIMOR SEA - THE USS MUSTIN (DDG 89) PARTICIPATED IN A SURFACE-ACTION-GROUP VERSUS SURFACE-ACTION-GROUP (SAG VS SAG) EXERCISE WITH THE ROYAL NEW ZEALAND NAVY ANZAC-CLASS FRIGATE HMNZS TE KAHA (F 77) DURING EXERCISE TALISMAN SABRE 2015.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN JOINS FORCES WITH NEW ZEALAND DURING TALISMAN SABRE
    3. Title: USS MUSTIN JOINS FORCES WITH NEW ZEALAND DURING TALISMAN SABRE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN SUSTAINS MARITIME SECURITY IN THE SOUTH CHINA SEA
    3. Title: USS MUSTIN SUSTAINS MARITIME SECURITY IN THE SOUTH CHINA SEA
    4. Description: TIMOR SEA - THE USS MUSTIN (DDG 89) PREPARES TO COME ALONGSIDE THE MILITARY SEALIFT COMMAND FLEET REPLENISHMENT OILER USNS RAPPAHANNOCK (T-AO 204) AS THE SHIP CONDUCTS A REPLENISHMENT-AT-SEA WITH THE USS GEORGE WASHINGTON (CVN 73) DURING EXERCISE TALISMAN SABRE 2015.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN SUSTAINS MARITIME SECURITY IN THE SOUTH CHINA SEA
    3. Title: USS MUSTIN SUSTAINS MARITIME SECURITY IN THE SOUTH CHINA SEA
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN VISITS BUSAN
    3. Title: USS MUSTIN VISITS BUSAN
    4. Description: THE ARLEIGH BURKE-CLASS GUIDED MISSILE DESTROYER USS MUSTIN (DDG 89) ARRIVED IN BUSAN FOR A PORT VISIT 12 AUG.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN VISITS BUSAN
    3. Title: DDG89
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN VISITS HONG KONG
    3. Title: USS MUSTIN VISITS HONG KONG
    4. Description: THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) ARRIVED IN HONG KONG FEB. 13 FOR A PORT VISIT DURING A ROUTINE PATROL IN THE 7TH FLEET AREA OF OPERATIONS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN VISITS HONG KONG
    3. Title: USS MUSTIN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTIN(DDG89)RASINSOUTHCHINASEA
    3. Title: SAILORS ASSIGNED TO THE GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) HEAVE A LINE DURING A REPLENISHMENT AT SEA
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTIN(DDG89)RASINSOUTHCHINASEA
    3. Title: USS MUSTIN (DDG89) RAS IN SOUTH CHINA SEA
    4. Description: SOUTH CHINA SEA - SAILORS ASSIGNED TO THE GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) HEAVE A LINE DURING A REPLENISHMENT AT SEA WITH THE MILITARY SEALIFT COMMAND FLEET REPLENISHMENT OILER USNS TIPPECANOE (T-AO 199).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTIN(DDG89)COMMUNITYSERVICEINTHAILAND
    3. Title: USS MUSTIN (DDG 89) COMMUNITY SERVICE IN THAILAND
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTIN(DDG89)COMMUNITYSERVICEINTHAILAND
    3. Title: USS MUSTIN VISITS THE CAMILLIAN SOCIAL CENTER RAYONG
    4. Description: RAYONG, THAILAND - SONAR TECHNICIAN SEAMAN APPRENTICE TIA THACH, ASSIGNED TO USS MUSTIN (DDG 89), PLAYS FRISBEE WITH CHILDREN DURING A COMMUNITY SERVICE PROJECT AT THE CAMILLIAN SOCIAL CENTER RAYONG, AN ESTABLISHMENT FOR CHILDREN WHO SUFFER FROM HIV/AIDS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTIN(DDG89)GETSUNDERWAYFROMTHEJAPANMARITIMESDFKURE
    3. Title: USS MUSTIN (DDG 89) GETS UNDERWAY FROM THE JAPAN MARITIME SDF BASE KURE
    4. Description: LT. MICHAEL BONO WAVES GOODBYE TO MEMBERS OF THE JAPAN SELF-DEFENSE FORCE AS THE THE GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) GETS UNDERWAY FROM THE JAPAN MARITIME SELF-DEFENSE FORCE BASE KURE.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTIN(DDG89)GETSUNDERWAYFROMTHEJAPANMARITIMESDFKURE
    3. Title: USS MUSTIN (DDG 89) GETS UNDERWAY FROM THE JAPAN MARITIME SDF BASE KURE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTIN(DDG89)SAILOREXPLAINSTORPEDOTUBESTOROYALTHAINAVY
    3. Title: USS MUSTIN (DDG 89) GUNNERS MATE 3RD CLASS KATHERINE CURTIS EXPLAINS TORPEDO TUBES TO ROYAL THAI NAVY
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTIN(DDG89)SAILOREXPLAINSTORPEDOTUBESTOROYALTHAINAVY
    3. Title: USS MUSTIN (DDG 89) SAILOR EXPLAINS TORPEDO TUBES TO ROYAL THAI NAVY
    4. Description: LAEM CHABANG, THAILAND - GUNNER'S MATE 3RD CLASS KATHERINE CURTIS, ASSIGNED TO THE GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89), EXPLAINS TO ROYAL THAI NAVY SAILORS HOW THE SHIP'S OVER-THE-SIDE TORPEDO TUBES OPERATE DURING A TOUR OF THE SHIP.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTIN(DDG89)SAILORSHANGLANYARDATYAMATOMUSEUM(JAPAN)
    3. Title: USS MUSTIN (DDG 89) SAILORS HANG LANYARD AT YAMATO MUSEUM (JAPAN)
    4. Description: CHIEF BOATSWAIN'S MATE ADAM MELANCON (RIGHT) AND CHIEF SHIP'S SERVICEMAN WARREN BROWN, ASSIGNED TO USS MUSTIN (DDG 89), SPLICE A LANYARD TO A REPLICA BELL AT THE YAMATO MUSEUM IN KURE, JAPAN.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTIN(DDG89)SAILORSHANGLANYARDATYAMATOMUSEUM(JAPAN)
    3. Title: USS MUSTIN (DDG 89) SAILORS HANG LANYARD AT YAMATO MUSEUM (JAPAN)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTIN(DDG89)SAILORSVISITIMPERIALJAPANESENAVYMEMORIAL
    3. Title: USS MUSTIN (DDG 89) SAILORS VISIT IMPERIAL JAPANESE NAVY MEMORIAL
    4. Description: KURE, JAPAN - MITSUYOSHI KAJIMOTO, A FORMER MEMBER OF THE IMPERIAL JAPANESE NAVY, WELCOMES USS MUSTIN (DDG 89) SAILORS TO THE IMPERIAL JAPANESE NAVY MEMORIAL DURING A COMMUNITY SERVICE CLEANUP PROJECT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTIN(DDG89)SAILORSVISITIMPERIALJAPANESENAVYMEMORIAL
    3. Title: USS MUSTIN (DDG 89) SAILORS WELCOMED BY MITSUYOSHI KAJIMOTO, A FORMER MEMBER OF THE IMPERIAL JAPANESE NAVY
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINAIDSINPHILIPPINESDISASTERRELIEF
    3. Title: USS MUSTIN AIDS IN PHILIPPINES DISASTER RELIEF
    4. Description: ORMAC,PHILIPPINES - SAILORS ASSIGNED TO THE FORWARD-DEPLOYED ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN BEGAN ASSISTING IN THE HUMANITARIAN ASSISTANCE DISASTER RELIEF MISSION OPERATION DAMAYAN.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINAIDSINPHILIPPINESDISASTERRELIEF
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINARRIVESINHONGKONGGIVESBACKTOTHECOMMUNITY
    3. Title: USS MUSTIN ARRIVES IN HONG KONG, GIVES BACK TO THE COMMUNITY
    4. Description: HONG KONG - SAILORS ASSIGNED TO THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) HAUL IN A LINE AS THE SHIP MOORS FOR A PORT VISIT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINARRIVESINHONGKONGGIVESBACKTOTHECOMMUNITY
    3. Title: USS MUSTIN ARRIVES IN HONG KONG, GIVES BACK TO THE COMMUNITY
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINARRIVESINMALAYSIAFORVISIT
    3. Title: USS MUSTIN ARRIVES IN MALAYSIA FOR VISIT
    4. Description: PORT KLANG, MALAYSIA - GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) ARRIVED IN PORT KLANG FOR A GOODWILL PORT VISIT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINARRIVESINMALAYSIAFORVISIT
    3. Title: USS MUSTIN IN PORT KLANG, MALAYSIA
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINARRIVESINTHAILAND
    3. Title: USS MUSTIN (DDG 89) ANCHORED OFF THE SHORELINE OF CAMBODIA (U.S. NAVY FILE PHOTO)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINARRIVESINTHAILAND
    3. Title: USS MUSTIN ARRIVES IN THAILAND
    4. Description: LAEM CHABANG, THAILAND - THE GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) ARRIVED IN LAEM CHABANG, THAILAND OCT. 21 FOR A PORT VISIT AND TO PARTICIPATE IN COMMUNITY SERVICE EVENTS IN ORDER TO STRENGTHEN TIES BETWEEN THE U.S. AND THE KINGDOM OF THAILAND.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINCONDUCTSSHIP WIDEZONEINSPECTIONS
    3. Title: USS MUSTIN CONDUCTS SHIP-WIDE ZONE INSPECTIONS
    4. Description: PACIFIC OCEAN (NOV. 30, 2010) – GAS TURBINE SYSTEMS TECHNICIAN-ELECTRIC 1ST CLASS DANIEL JACOB AND ENSIGN RYAN BIESHAAR RECORD THE IDENTIFICATION NUMBER OF A PIECE OF EQUIPMENT ON THE USS MUSTIN (DDG 89) DURING A SHIP-WIDE INSPECTION CHECK.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINCONDUCTSSHIP WIDEZONEINSPECTIONS
    3. Title: USS MUSTIN CONDUCTS SHIP-WIDE ZONE INSPECTIONS
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINDDG89CONDUCTSAREPLENISHMENTATSEA
    3. Title: USS MUSTIN (DDG 89) CONDUCTS A REPLENISHMENT-AT-SEA
    4. Description: SOUTH CHINA SEA (DEC. 2, 2010) - CHIEF BOATSWAIN’S MATE FOR THE GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) ADAM MELANCON LOOKS ON AS THE MUSTIN CONDUCTS A REPLENISHMENT-AT-SEA (RAS) EVOLUTION WITH THE MILITARY SEALIFT COMMAND FLEET REPLENISHMENT OILER USNS PECOS (T-AO 197).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINDDG89CONDUCTSAREPLENISHMENTATSEA
    3. Title: USS MUSTING (DDG 89) REPLENISHMENT AT SEA
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINDEPARTSCAMBODIAAFTERAFOUR DAYPORTVISIT
    3. Title: USS MUSTIN (DDG 89) ANCHORS OUT AT SEA
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINDEPARTSCAMBODIAAFTERAFOUR DAYPORTVISIT
    3. Title: USS MUSTIN DEPARTS CAMBODIA AFTER A FOUR-DAY PORT VISIT
    4. Description: SIHANOUKVILLE, CAMBODIA (DEC. 7, 2010) - THE GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) ANCHORS OUT AT SEA OFF THE SHORELINE OF SIHANOUKVILLE, CAMBODIA.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINDEPARTSSINGAPORE
    3. Title: USS MUSTIN (DDG 89)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINDEPARTSSINGAPORE
    3. Title: USS MUSTIN DEPARTS SINGAPORE
    4. Description: ARLEIGH BURKE-CLASS GUIDED MISSILE DESTROYER USS MUSTIN (DDG 89) DEPARTED CHANGI NAVAL BASE, SINGAPORE, JULY 26, AFTER A SCHEDULED VOYAGE REPAIR MAINTENANCE PERIOD.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINHOSTSCFAYSPRINGFESTIVALSHIPTOURS
    3. Title: USS MUSTIN HOSTS CFAY SPRING FESTIVAL SHIP TOURS
    4. Description: YOKOSUKA, JAPAN - U.S. NAVY ELECTRONICS TECHNICIAN 3RD CLASS JOSEPH HOCHMAN, LEFT, AND INTERIOR COMMUNICATIONS ELECTRICIAN 3RD CLASS ZAQUAVIUS GRISSOM POSE FOR A PHOTO WITH JAPANESE VISITORS ABOARD USS MUSTIN.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINHOSTSCFAYSPRINGFESTIVALSHIPTOURS
    3. Title: USS MUSTIN HOSTS CFAY SPRING FESTIVAL
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINHOSTSASHIPTOURFORREPUBLICOFKOREANAVYSAILORS
    3. Title: DAMAGE CONTROLMAN FIRST CLASS ANTONINO GARCIA DEMONSTRATES COMMUNICATIONS METHODS TO REPUBLIC OF KOREA NAVY SAILORS.
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINHOSTSASHIPTOURFORREPUBLICOFKOREANAVYSAILORS
    3. Title: USS MUSTIN HOSTS A SHIP TOUR FOR REPUBLIC OF KOREA NAVY SAILORS
    4. Description: REPUBLIC OF KOREA (MARCH 11, 2012) - DAMAGE CONTROLMAN FIRST CLASS ANTONINO GARCIA DEMONSTRATES COMMUNICATIONS METHODS TO REPUBLIC OF KOREA NAVY SAILORS WHILE CONDUCTING A TOUR ABOARD GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINRETURNSTOYOKOSUKAFOLLOWING3MONTHPATROL
    3. Title: USS MUSTIN (DDG89)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINRETURNSTOYOKOSUKAFOLLOWING3MONTHPATROL
    3. Title: USS MUSTIN RETURNS TO YOKOSUKA FOLLOWING 3-MONTH PATROL
    4. Description: YOKOSUKA, JAPAN - GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) SAILORS RETURNED TO GREETINGS FROM FAMILY AND FRIENDS IN YOKOSUKA, JAPAN, FOLLOWING THEIR THREE-MONTH PATROL IN THE 7TH FLEET AREA OF OPERATIONS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINSUPPORTSLOCALCOMMUNITIESDURINGTHAILANDVISIT
    3. Title: USS MUSTIN (DDG 89) TECHNICIAN HELPS PREPARE PACKAGED GOODS DURING COMMUNITY SERVICE IN THAILAND
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINSUPPORTSLOCALCOMMUNITIESDURINGTHAILANDVISIT
    3. Title: USS MUSTIN SUPPORTS LOCAL COMMUNITIES DURING THAILAND VISIT
    4. Description: BANGKOK - CHIEF CRYPTOLOGIC TECHNICIAN (COLLECTION) DANIEL LEONARD, ASSIGNED TO THE GUIDED MISSILE DESTROYER USS MUSTIN (DDG 89), HELPS A THAI RED CROSS SOCIETY VOLUNTEER MOVE BAGS OF RICE TO PREPARE PACKAGED GOODS KITS DURING A COMMUNITY SERVICE EVENT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINUSMARINESBLOWAWAYNSFSCERTIFICATION
    3. Title: USS MUSTIN, U.S. MARINES, BLOW AWAY NSFS CERTIFICATION
    4. Description: PACIFIC OCEAN - GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) SUCCESSFULLY COMPLETED ITS NAVAL SURFACE FIRE SUPPORT (NSFS) RECERTIFICATION.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINUSMARINESBLOWAWAYNSFSCERTIFICATION
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINVISITSTHAILANDDURING7THFLEETPATROL
    3. Title: USS MUSTIN VISITS THAILAND DURING 7TH FLEET PATROL
    4. Description: PATTAYA, THAILAND - THE FORWARD-DEPLOYED ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) ARRIVED IN PATTAYA, THAILAND FOR A PORT VISIT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINVISITSTHAILANDDURING7THFLEETPATROL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINAND7THFLEETORIENTEXPRESSBANDSAILORSBRINGJOYTOLOCALCOMMUNITY
    3. Title: USS MUSTIN (DDG 89), TAKES PART IN COMMUNITY SERVICE (COMSERV) PROJECT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINAND7THFLEETORIENTEXPRESSBANDSAILORSBRINGJOYTOLOCALCOMMUNITY
    3. Title: USS MUSTIN AND 7TH FLEET ORIENT EXPRESS BAND SAILORS BRING JOY TO LOCAL COMMUNITY
    4. Description: SIHANOUKVILLE, CAMBODIA (DEC. 4, 2010) - GUNNER’S MATE SEAMAN APPRENTICE JENNIFER WASHICK FROM POTTSVILLE, PA., ASSIGNED TO THE USS MUSTIN (DDG 89), TAKES PART IN COMMUNITY SERVICE (COMSERV) PROJECT WITH LOCAL CHILDREN AT THE GOODWILL SCHOOL, A LOCAL CHARITY ORGANIZATION AIMED AT EDUCATING CHILDREN IN SIHANOUKVILLE, CAMBODIA.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINARRIVESINISHIKARI
    3. Title: USS MUSTIN (DDG89)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USSMUSTINARRIVESINISHIKARI
    3. Title: USS MUSTIN ARRIVES IN ISHIKARI
    4. Description: ISHIKARI, JAPAN – THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) ARRIVED IN ISHIKARI FOR A PORT VISIT FEB. 6.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: VALIANTSHIELDEXERCISEKICKSOFFINPACIFIC
    3. Title: VALIANT SHIELD EXERCISE KICKS OFF IN PACIFIC
    4. Description: ANDERSEN AIR FORCE BASE, GUAM - EXERCISE VALIANT SHIELD 2014 KICKED OFF WITH MORE THAN 18,000 JOINT FORCE SERVICE MEMBERS FROM 30 UNITS, INCLUDING 200 AIRCRAFT AND 20 SHIPS IN, AND AROUND, THE ISLAND OF GUAM.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: VALIANTSHIELDEXERCISEKICKSOFFINPACIFIC
    3. Title: VALIANT SHIELD EXERCISE KICKS OFF IN PACIFIC
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: VICEADMSCOTTRVANBUSKIRKADDRESSESTHECREWOFUSSMUSTIN(DDG89)DURINGASHIPVISIT
    3. Title: COMMANDER OF U.S. 7TH FLEET ADDRESSES THE CREW OF USS MUSTIN
    4. Description: YOKOSUKA, JAPAN (APRIL 5, 2011) VICE ADM. SCOTT R. VAN BUSKIRK, COMMANDER OF U.S. 7TH FLEET, ADDRESSES THE CREW OF THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) DURING A SHIP VISIT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: VICEADMSCOTTRVANBUSKIRKADDRESSESTHECREWOFUSSMUSTIN(DDG89)DURINGASHIPVISIT
    3. Title: VICE ADM. SCOTT R. VAN BUSKIRK ADDRESSES THE CREW OF USS MUSTIN (DDG 89) DURING A SHIP VISIT.
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: WARFARE TACTICS INSTRUCTORS LEAD USS MUSTIN DURING MULTISAIL 17
    3. Title: USS MUSTIN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: WARFARE TACTICS INSTRUCTORS LEAD USS MUSTIN DURING MULTISAIL 17
    3. Title: WARFARE TACTICS INSTRUCTORS LEAD USS MUSTIN DURING MULTISAIL 17
    4. Description: WATERS OFF THE COAST OF GUAM (NNS) – WARFARE TACTICS INSTRUCTORS, WTI, FROM NAVAL SURFACE AND MINE WARFIGHTING DEVELOPMENT CENTER, (SMWDC) ADVISED THE COMMANDING OFFICER AND LED SURFACE WARFARE OFFICERS ABOARD THE FORWARD-DEPLOYED ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89), IN WARFARE, TACTICS AND TRAINING EXERCISES DURING MULTISAIL 2017, MAR. 6-10.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: WARRIORQUILTSBOOSTMORALEOFMUSTINSAILORSATSEA
    3. Title: WARRIOR QUILTS BOOST MORALE OF MUSTIN SAILORS AT SEA
    4. Description: YELLOW SEA – APPROXIMATELY 16 SAILORS ASSIGNED TO GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) RECEIVED HOMEMADE “WARRIOR QUILTS”, DONATED BY THE SONOMA AMERICAN LEGION, A CALIFORNIA-BASED COMMUNITY ORGANIZATION, AS A TOKEN OF APPRECIATION FOR THEIR MILITARY SERVICE.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: WARRIORQUILTSBOOSTMORALEOFMUSTINSAILORSATSEA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: WELCOMEABOARD
    3. Title: WELCOME ABOARD - USS MUSTIN
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO1 06AUG2015 23FEB2017
    3. Title: CDR THANE C. CLARE
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO1 06AUG2015 23FEB2017
    3. Title: COMMANDING OFFICER (AUGUST 6, 2015 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO1 13SEPTEMBER2018 2DECEMBER2019
    3. Title: CDR RYAN LEARY
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO1 13SEPTEMBER2018 2DECEMBER2019
    3. Title: SEPTEMBER 14, 2018 - PRESENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO1 24FEBRUARY2017 13SEPTEMBER2018
    3. Title: COMMANDING OFFICER
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO1 24FEBRUARY2017 13SEPTEMBER2018
    3. Title: FEBRUARY 24, 2017 - PRESENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO1 RELIEVED JUNE2012
    3. Title: CDR SCOTT A. TAIT
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO1 RELIEVED JUNE2012
    3. Title: CDR SCOTT A. TAIT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO1
    3. Title: (DECEMBER 3, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO1
    3. Title: CDR TODD PENROD
    4. Description: CURRENT COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO2 21MARCH2018 9AUGUST2019
    3. Title: CDR TODD PENRODD
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO2 21MARCH2018 9AUGUST2019
    3. Title: MARCH 21, 2018 - PRESENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO2 23NOVEMBER2016 20MARCH2018
    3. Title: CDR RAY GAMICCHIA
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO2 23NOVEMBER2016 20MARCH2018
    3. Title: EXECUTIVE OFFICER (NOVEMBER 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO2 JULY2015 NOV2016
    3. Title: CDR WARREN SMITH
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO2 JULY2015 NOV2016
    3. Title: EXECUTIVE OFFICER (JULY 11, 2015 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO2
    3. Title: (AUGUST 10, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO2
    3. Title: CDR COORE
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO3 11MARCH2017 25MAY2019
    3. Title: CMDCM GEOFFREY BUSSCHER
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO3 11MARCH2017 25MAY2019
    3. Title: MARCH 11, 2017 - PRESENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO3 15JANUARY2015 7AUGUST2016
    3. Title: CMDCM(SW/AW) ISRAEL PEDREGON
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO3 15JANUARY2015 7AUGUST2016
    3. Title: COMMAND MASTER CHIEF (JANUARY 15, 2015 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO3 17AUGUST2016 10MARCH2017
    3. Title: (AUGUST 8, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO3 17AUGUST2016 10MARCH2017
    3. Title: CMDCM(SW/AW) ISRAEL PEDREGON
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO3 2MAY2012 5JAN2015
    3. Title: CMDCM(SW/AW) STEVEN J. SNYDER
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO3 2MAY2012 5JAN2015
    3. Title: CMDCM(SW/AW) STEVEN J. SNYDER
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO3 MAY2012 RELIEVED
    3. Title: CMDCM(SW/AW) RACHEL COSTELLO
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO3 MAY2012 RELIEVED
    3. Title: CMDCM(SW/AW) RACHEL COSTELLO
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO3
    3. Title: (JUNE 26, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: BIO3
    3. Title: CMDCM TROY A. BOJORQUIZ
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: DEFAULT
    3. Title: USS MUSTIN (DDG 89)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: DEFAULT
    3. Title: USS MUSTIN (DDG 89)
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: FAMILY
    3. Title: FAMILY - USS MUSTIN
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MIDSHIPMENABOARDMUSTIN
    3. Title: MIDSHIPMEN EXPERIENCE NAVY ABOARD USS MUSTIN
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MIDSHIPMENABOARDMUSTIN
    3. Title: MIDSHIPMEN EXPERIENCE NAVY ABOARD USS MUSTIN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINDEPARTSMAL
    3. Title: MUSTIN DEPARTS MALAYSIA AFTER INTERNATIONAL EXHIBITION
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: MUSTINDEPARTSMAL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: NAMESAKE
    3. Title: NAMED TO HONOR THE MUSTIN FAMILY
    4. Description: THE USS MUSTIN (DDG 89) IS NAMED TO HONOR THE MUSTIN FAMILY WHO HAVE RECORDED A RICH AND HONORABLE TRADITION OF NAVAL SERVICE. THE MUSTIN’S LEGACY TO THE NAVY SERVICE LASTED FROM 1896 UNTIL 1989;NEARLY ONE CENTURY OF NAVAL HISTORY.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: OURSHIP
    3. Title: ABOUT US
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: PHOTOS
    3. No title
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN ARRIVES IN CAMBODIA TO BEGIN CARAT 14
    3. Title: USS MUSTIN ARRIVES IN CAMBODIA TO BEGIN CARAT 14
    4. Description: SIHANOUKVILLE, CAMBODIA - THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) ARRIVED IN CAMBODIA TO COMMENCE THE 5TH ANNUAL COOPERATION AFLOAT READINESS AND TRAINING (CARAT) CAMBODIA EXERCISE WITH THE OPENING CEREMONY TO BE HELD AT THE ROYAL CAMBODIAN REAM NAVAL BASE.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN ARRIVES IN CAMBODIA TO BEGIN CARAT 14
    3. Title: USS MUSTIN ARRIVES IN CAMBODIA TO BEGIN CARAT 14
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN SHARES NAVY LIFE WITH JAPAN
    3. Title: USS MUSTIN SHARES NAVY LIFE WITH JAPAN
    4. Description: YOKOSUKA, JAPAN - DAMAGE CONTROLMAN THIRD CLASS PETTY OFFICER WESLEY FOSTER POSES WITH JAPANESE VISITORS ON BOARD ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) DURING COMMANDER, FLEET ACTIVITIES YOKOSUKA'S SPRING FESTIVAL.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN SHARES NAVY LIFE WITH JAPAN
    3. Title: USS MUSTIN SHARES NAVY LIFE WITH JAPAN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN VISITS OTARU
    3. Title: USS MUSTIN VISITS OTARU
    4. Description: OTARU, JAPAN - THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) PULLS INTO OTARU FOR A SCHEDULED PORT VISIT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN VISITS OTARU
    3. Title: USS MUSTIN VISITS OTARU
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN VISITS PYEONGTAEK TO ENHANCE PARTNERSHIPS WITH KOREAN NAVY
    3. Title: USS MUSTIN VISITS PYEONGTAEK TO ENHANCE PARTNERSHIPS WITH KOREAN NAVY
    4. Description: PYEONGTAEK, REPUBLIC OF KOREA - THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) ARRIVED IN PYEONGTAEK, REPUBLIC OF KOREA, FOR A PORT VISIT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PAGES
    2. File: USS MUSTIN VISITS PYEONGTAEK TO ENHANCE PARTNERSHIPS WITH KOREAN NAVY
    3. Title: USS MUSTIN VISITS PYEONGTAEK TO ENHANCE PARTNERSHIPS WITH KOREAN NAVY
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: 100619 N 2562W MUSTIN UNDERWAY REPLENISHMENT
    3. Title: PHILIPPINE SEA - THE ARLEIGH BURKE-CLASS DESTROYER USS MUSTIN (DDG 89) CONNECTS WITH THE OILER USNS WALTER S. DIEHL (T-AO 193)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: 101129 N 8721D 012
    3. Title: USS MUSTIN (DDG 89) FROCKS NEARLY TWO DOZEZ SAILORS IN AT-SEA CEREMONY
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: 101130 N 8721D 028
    3. Title: USS MUSTIN CONDUCTS SHIP-WIDE ZONE INSPECTIONS
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: 101203 N 8721D 026
    3. Title: CAMBODIA PORT VISIT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: 101204 N 8721D 027
    3. Title: USS MUSTIN (DDG 89), TAKES PART IN COMMUNITY SERVICE (COMSERV) PROJECT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: 101207 N 8721 002
    3. Title: USS MUSTIN (DDG89)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: 101222 N 9330N 680
    3. Title: CO OF USS MUSTIN, CMDR. MICHAEL MISIEWICZ WELCOMES TOKIHIKO UMEZAKI, CO OF JAPAN MARITIME SELF-DEFENSE FORCE IKAZUCHI
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: 110128 N 1871M 138
    3. Title: CMDR. MICHAEL V. MISIEWICZ DEPARTS AS CMDR. SCOTT A. TAIT, COMMANDING OFFICER OF THE USS MUSTIN.
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: 110917 N EA192 008 SEPT 2011 IMPERIAL JAPANESE NAVY MEMORIAL
    3. Title: USS MUSTIN (DDG 89) SAILORS WELCOMED BY MITSUYOSHI KAJIMOTO, A FORMER MEMBER OF THE IMPERIAL JAPANESE NAVY
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: 110919 N EA192 057 USS MUSTIN DDG89 SEPT 2011 YAMATO MUSEUM
    3. Title: USS MUSTIN (DDG 89) SAILORS HANG LANYARD AT YAMATO MUSEUM (JAPAN)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: 111207 N IO627 006
    3. Title: USS MUSTIN DDG89
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: 111214 N RM161 087
    3. Title: USS MUSTIN (DDG89)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: 120206 N 20TX232 478
    3. Title: SAILORS ASSIGNED TO USS MUSTIN STAND BY AS THE SHIP RETURNS TO SEA AFTER A MAINTENANCE PERIOD IN DRY DOCK.
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: 121016 N MU720 190
    3. Title: GUNNER'S MATE 2ND CLASS NICHOLAS PAUL AND LT. BRADLEY WILLIFORD, POSE WITH PAUL'S "WARRIOR QUILT"AND PILLOWCASE.
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: 8025795814 0C4C715163 B
    3. Title: USS MUSTIN IN PORT KLANG, MALAYSIA
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: DDG89 ANCHORED CAMBODIA 101207 N 8721D 002
    3. Title: USS MUSTIN (DDG 89) ANCHORED OFF THE SHORELINE OF CAMBODIA (U.S. NAVY FILE PHOTO)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: DDG89 RAS TIPPECANOE SOUTH CHINA SEA
    3. Title: SAILORS ASSIGNED TO THE GUIDED-MISSILE DESTROYER USS MUSTIN (DDG 89) HEAVE A LINE DURING A REPLENISHMENT AT SEA
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: DDG89 SAILOR DESCRIBES TORPEDO TUBES WEB 111101 N EA192 051
    3. Title: USS MUSTIN (DDG 89) GUNNERS MATE 3RD CLASS KATHERINE CURTIS EXPLAINS TORPEDO TUBES TO ROYAL THAI NAVY
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: DDG89 THAILAND FOOD DELIVERY 6284480397 26E0A14890
    3. Title: USS MUSTIN (DDG 89) TECHNICIAN HELPS PREPARE PACKAGED GOODS DURING COMMUNITY SERVICE IN THAILAND
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: DDG89 THAILAND HUMANITARIAN111022 N EA192 009
    3. Title: USS MUSTIN (DDG 89) COMMUNITY SERVICE IN THAILAND
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: USS MUSTIN DDG89 DEPARTS JSDF KURE WEB 110922 N EA192 023
    3. Title: USS MUSTIN (DDG 89) GETS UNDERWAY FROM THE JAPAN MARITIME SDF BASE KURE
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PHOTOS
    2. File: WEB 110405 N 9330N 003
    3. Title: VICE ADM. SCOTT R. VAN BUSKIRK ADDRESSES THE CREW OF USS MUSTIN (DDG 89) DURING A SHIP VISIT.
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: 160428 N ZZ999 301
    3. Title: RETIRED VICE ADM. HENRY C. MUSTIN
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: 161215 N XK398 013
    3. Title: DDG89
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: 170224 N HE318 147
    3. Title: USS MUSTIN (DDG89)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: 170301 N GP548 557
    3. Title: USS MUSTIN (DDG89)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: 170317 N GP548 168
    3. Title: CHIEF PERSONNEL SPECIALIST ALBERTO MARTINEZ
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: 170519 N VG727 001
    3. Title: USS MUSTIN (DDG89)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: 180313 N HE318 0003
    3. Title: DDG89
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: 180313 N HE318 0003
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: CDR COORE SMALL
    3. Title: (AUGUST 10, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: CDR COORE
    3. Title: (AUGUST 10, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: CDR LEARY SMALL
    3. Title: SEPTEMBER 14, 2018 - PRESENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: CDR LEARY
    3. Title: SEPTEMBER 14, 2018 - PRESENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: CDR PENROD SMALL
    3. Title: (DECEMBER 3, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: CDR PENROD
    3. Title: (DECEMBER 3, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: CDR DDG89 THUMBNAIL
    3. Title: CDR JOSEPH J. RING
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: CDR DDG89
    3. Title: CDR JOSEPH J. RING
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: CMC PEDREGON SMALL
    3. Title: COMMAND MASTER CHIEF (JANUARY 15, 2015 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: CMC PEDREGON
    3. Title: COMMAND MASTER CHIEF (JANUARY 15, 2015 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: CMDCM BOJORQUIZ SMALL
    3. Title: (JUNE 26, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: CMDCM BOJORQUIZ
    3. Title: (JUNE 26, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: CMDCM SNYDER SMALL
    3. Title: CMDCM(SW/AW) STEVEN J. SNYDER
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: CO CLARE
    3. Title: COMMANDING OFFICER (AUGUST 6, 2015 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: CO TORRES SMALL
    3. Title: CDR JOSEPH A. TORRES JR.
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: CO WARRENSMITH
    3. Title: FEBRUARY 24, 2017 - PRESENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: CO
    3. Title: CDR SCOTT A. TAIT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: XO BERNARD SMALL
    3. Title: LCDR PETER M. BERNARD
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: XO BERNARD
    3. Title: LCDR PETER M. BERNARD
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: XO CLARE SMALL
    3. Title: CDR THANE C. CLARE
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: XO CLARE
    3. Title: CDR THANE C. CLARE
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: XO SMITH SMALL
    3. Title: EXECUTIVE OFFICER (JULY 11, 2015 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: XO SULLIVAN
    3. Title: LCDR COLLIN C. SULLIVAN
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: XO TORRES SMALL
    3. Title: CDR JOSEPH A. TORRES JR.
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: XO TORRES
    3. Title: CDR JOSEPH A. TORRES JR.
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: CMC BUSSCHER
    3. Title: MARCH 11, 2017 - PRESENT
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: GMCS CARTER SMALL
    3. Title: (AUGUST 8, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: LOGO ACTUAL
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: LOGO ACTUAL
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: MUSTIN CMC
    3. Title: CMDCM(SW/AW) RACHEL COSTELLO
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: MUSTINFAMILY
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: MUSTIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: OLDSHIP2
    3. Title: MUSTIN
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: OLDSHIP
    3. Title: MUSTIN
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: XO SM
    3. Title: EXECUTIVE OFFICER (NOVEMBER 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: PUBLISHINGIMAGES
    2. File: XO
    3. Title: EXECUTIVE OFFICER (NOVEMBER 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: REPLENISHMENT AT SEA
    2. File: 101202 N 8721D 113
    3. Title: USS MUSTING (DDG 89) REPLENISHMENT AT SEA
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: 356CPOTRAININGONUSSMUSTIN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: 356CPOTRAININGONUSSMUSTIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: ANTIETAM MUSTIN BUILD FOSTER RELATIONSHIPS IN SYDNEY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: ANTIETAM MUSTIN BUILD FOSTER RELATIONSHIPS IN SYDNEY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO1 02APR2014 05AUG2015
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO1 02APR2014 05AUG2015
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO1 13JUN2012 01APR2014
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO1 13JUN2012 01APR2014
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO2 16MAY2013 MAR2014
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO2 16MAY2013 MAR2014
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO2 MAR2014 JUL2015
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO2 MAR2014 JUL2015
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO2 RELIEVEDAUG2012
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO2 RELIEVEDAUG2012
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO2 SEP2012 16MAY2013
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO2 SEP2012 16MAY2013
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO2
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO2
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO3
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO3
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: CTF70ADMIRALVISITSUSSMUSTINATSEA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: CTF70ADMIRALVISITSUSSMUSTINATSEA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: CAMBODIAN BORNCOMMANDERVISITSHISHOMELAND
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: CAMBODIAN BORNCOMMANDERVISITSHISHOMELAND
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: CHANGEOFCOMMANDONBOARDUSSMUSTIN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: CHANGEOFCOMMANDONBOARDUSSMUSTIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: CHRISTMASFESTIVITIESABOARDUSSMUSTIN(DDG89)
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: CHRISTMASFESTIVITIESABOARDUSSMUSTIN(DDG89)
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: COMMANDERBATTLEFORCE7THFLEETVISITSUSSMUSTIN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: COMMANDERBATTLEFORCE7THFLEETVISITSUSSMUSTIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: FAMILY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: FAMILY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: FLIGHTOPERATIONSATSEAONUSSMUSTIN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: FLIGHTOPERATIONSATSEAONUSSMUSTIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: GENERALQUARTERSDRILLONUSSMUSTIN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: GENERALQUARTERSDRILLONUSSMUSTIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: JOHNSMCCAINMUSTINJOIN75THBLACKSHIPFESTIVAL
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: JOHNSMCCAINMUSTINJOIN75THBLACKSHIPFESTIVAL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUNISING MICHIGAN NATIVE SERVES ABOARD USS MUSTIN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUNISING MICHIGAN NATIVE SERVES ABOARD USS MUSTIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTIN CHIEF EARNS COMMISSIONING TO WARRANT OFFICER
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTIN CHIEF EARNS COMMISSIONING TO WARRANT OFFICER
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTIN HSM 51 NAMED 2014 SHIP HELICOPTER SAFETY AWARD WINNERS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTIN HSM 51 NAMED 2014 SHIP HELICOPTER SAFETY AWARD WINNERS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTIN HONORS THE PASSING OF THEIR NAMESAKE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTIN HONORS THE PASSING OF THEIR NAMESAKE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTIN SAILORS PAUSE TO REMEMBER WWII ERA USS JOHNSTON
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTIN SAILORS PAUSE TO REMEMBER WWII ERA USS JOHNSTON
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTIN,KAZUCHIRECONFIRMSISTERSHIPRELATIONSHIP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTIN,KAZUCHIRECONFIRMSISTERSHIPRELATIONSHIP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINCONDUCTSVERTREPRASWITHUSNSAMELIAEARHART
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINCONDUCTSVERTREPRASWITHUSNSAMELIAEARHART
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINDEPARTSDRYDOCKINYOKOSUKAJAPAN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINDEPARTSDRYDOCKINYOKOSUKAJAPAN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINFROCKSNEARLYTWODOZENSAILORSINAT SEACEREMONY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINFROCKSNEARLYTWODOZENSAILORSINAT SEACEREMONY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINFURTHERSSUICIDEPREVENTIONAWARENESS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINFURTHERSSUICIDEPREVENTIONAWARENESS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINHSL51DET6ENJOYTHANKSGIVINGINEASTCHINASEA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINHSL51DET6ENJOYTHANKSGIVINGINEASTCHINASEA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINHSL51DET6FROCK46NEWPETTYOFFICERS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINHSL51DET6FROCK46NEWPETTYOFFICERS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINHONORNAVYBIRTHDAYWITHBELLRINGINGCAKECUTTINGCEREMONY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINHONORNAVYBIRTHDAYWITHBELLRINGINGCAKECUTTINGCEREMONY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINHOSTSESWSRODEO
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINHOSTSESWSRODEO
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINJOHNSMCCAINSAILORSVISITSCHOOLCHILDRENDURINGBLACKSHIPFESTIVAL
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINJOHNSMCCAINSAILORSVISITSCHOOLCHILDRENDURINGBLACKSHIPFESTIVAL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINSAILORSCELEBRATECENTENNIALOFNAVALAVIATION
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINSAILORSCELEBRATECENTENNIALOFNAVALAVIATION
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINSAILORSTAKEE6ADVANCEMENTEXAMATSEA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINSAILORSTAKEE6ADVANCEMENTEXAMATSEA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINSUPPORTSOPERATIONDAMAYAN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINSUPPORTSOPERATIONDAMAYAN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINWELCOMESSIXNEWCPOSINTOTHEMESS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINWELCOMESSIXNEWCPOSINTOTHEMESS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: NAVY LEADER PASSES AWAY, LEAVES LEGACY IN SURFACE WARFARE COMMUNITY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: NAVY LEADER PASSES AWAY, LEAVES LEGACY IN SURFACE WARFARE COMMUNITY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: NEW YORK NATIVE SERVES ABOARD USS MUSTIN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: NEW YORK NATIVE SERVES ABOARD USS MUSTIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: NEWS ARCHIVE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: NEWS ARCHIVE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: PACIFICFLEETCOMMANDERVISITSUSSMUSTINPRAISESCREWINMALAYSIA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: PACIFICFLEETCOMMANDERVISITSUSSMUSTINPRAISESCREWINMALAYSIA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: PASTLEADERSHIP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: PASTLEADERSHIP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: PHOTOS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: PHOTOS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: PINESVILLE NATIVE SERVES ABOARD USS MUSTIN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: PINESVILLE NATIVE SERVES ABOARD USS MUSTIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: ROK CSOFEX09 3
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: ROK CSOFEX09 3
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: REPLENISHMENTATSEAONUSSMUSTIN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: REPLENISHMENTATSEAONUSSMUSTIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: REQUEST A SPONSOR SPLASH
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: REQUEST A SPONSOR SPLASH
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: SEVENTHFLEETTESTSINNOVATIVEMISSILEDEFENSESYSTEM
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: SEVENTHFLEETTESTSINNOVATIVEMISSILEDEFENSESYSTEM
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: UNREP PHILLIPPINESEA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: UNREP PHILLIPPINESEA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: US THAILAND CONCLUDE CARAT THAILAND 2018
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: US THAILAND CONCLUDE CARAT THAILAND 2018
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: US AND KOREAN NAVIES EMBRACE TRAINING OPPORTUNITIES DURING JANUARY BILATERAL EXCHANGE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: US AND KOREAN NAVIES EMBRACE TRAINING OPPORTUNITIES DURING JANUARY BILATERAL EXCHANGE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN PROCEEDING OUT TO SEA FROM YOKOSUKA NAVAL BASE JAPAN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN PROCEEDING OUT TO SEA FROM YOKOSUKA NAVAL BASE JAPAN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN (DDG 89) ARRIVES IN CAM RANH INTERNATIONAL PORT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN (DDG 89) ARRIVES IN CAM RANH INTERNATIONAL PORT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN ARRIVES FOR BLACK SHIP FESTIVAL
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN ARRIVES FOR BLACK SHIP FESTIVAL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN ARRIVES FOR PORT VISIT IN GUAM DURING MULTISAIL 18
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN ARRIVES FOR PORT VISIT IN GUAM DURING MULTISAIL 18
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN ARRIVES FOR PORT VISIT IN GUAM
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN ARRIVES FOR PORT VISIT IN GUAM
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN ARRIVES IN GUAM
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN ARRIVES IN GUAM
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN ARRIVES IN OTARU JAPAN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN ARRIVES IN OTARU JAPAN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN CHIEF PETTY OFFICERS HOST 127TH BIRTHDAY CELEBRATION
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN CHIEF PETTY OFFICERS HOST 127TH BIRTHDAY CELEBRATION
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN CONDUCTS NAVY SURFACE FIRING SUPPORT RECERTIFICATION
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN CONDUCTS NAVY SURFACE FIRING SUPPORT RECERTIFICATION
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN DDG 89 ARRIVES IN CAM RANH INTERNATIONAL PORT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN DDG 89 ARRIVES IN CAM RANH INTERNATIONAL PORT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN DEPARTS SHIMODA BLACK SHIP FESTIVAL
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN DEPARTS SHIMODA BLACK SHIP FESTIVAL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN HOLDS CHANGE OF COMMAND
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN HOLDS CHANGE OF COMMAND
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN JOINS FORCES WITH NEW ZEALAND DURING TALISMAN SABRE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN JOINS FORCES WITH NEW ZEALAND DURING TALISMAN SABRE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN SUSTAINS MARITIME SECURITY IN THE SOUTH CHINA SEA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN SUSTAINS MARITIME SECURITY IN THE SOUTH CHINA SEA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN VISITS BUSAN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN VISITS BUSAN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN VISITS HONG KONG
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN VISITS HONG KONG
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTIN(DDG89)RASINSOUTHCHINASEA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTIN(DDG89)RASINSOUTHCHINASEA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTIN(DDG89)COMMUNITYSERVICEINTHAILAND
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTIN(DDG89)COMMUNITYSERVICEINTHAILAND
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTIN(DDG89)GETSUNDERWAYFROMTHEJAPANMARITIMESDFKURE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTIN(DDG89)GETSUNDERWAYFROMTHEJAPANMARITIMESDFKURE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTIN(DDG89)SAILOREXPLAINSTORPEDOTUBESTOROYALTHAINAVY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTIN(DDG89)SAILOREXPLAINSTORPEDOTUBESTOROYALTHAINAVY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTIN(DDG89)SAILORSHANGLANYARDATYAMATOMUSEUM(JAPAN)
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTIN(DDG89)SAILORSHANGLANYARDATYAMATOMUSEUM(JAPAN)
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTIN(DDG89)SAILORSVISITIMPERIALJAPANESENAVYMEMORIAL
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTIN(DDG89)SAILORSVISITIMPERIALJAPANESENAVYMEMORIAL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINAIDSINPHILIPPINESDISASTERRELIEF
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINAIDSINPHILIPPINESDISASTERRELIEF
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINARRIVESINHONGKONGGIVESBACKTOTHECOMMUNITY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINARRIVESINHONGKONGGIVESBACKTOTHECOMMUNITY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINARRIVESINMALAYSIAFORVISIT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINARRIVESINMALAYSIAFORVISIT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINARRIVESINTHAILAND
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINARRIVESINTHAILAND
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINCONDUCTSSHIP WIDEZONEINSPECTIONS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINCONDUCTSSHIP WIDEZONEINSPECTIONS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINDDG89CONDUCTSAREPLENISHMENTATSEA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINDDG89CONDUCTSAREPLENISHMENTATSEA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINDEPARTSCAMBODIAAFTERAFOUR DAYPORTVISIT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINDEPARTSCAMBODIAAFTERAFOUR DAYPORTVISIT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINDEPARTSSINGAPORE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINDEPARTSSINGAPORE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINHOSTSCFAYSPRINGFESTIVALSHIPTOURS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINHOSTSCFAYSPRINGFESTIVALSHIPTOURS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINHOSTSASHIPTOURFORREPUBLICOFKOREANAVYSAILORS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINHOSTSASHIPTOURFORREPUBLICOFKOREANAVYSAILORS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINRETURNSTOYOKOSUKAFOLLOWING3MONTHPATROL
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINRETURNSTOYOKOSUKAFOLLOWING3MONTHPATROL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINSUPPORTSLOCALCOMMUNITIESDURINGTHAILANDVISIT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINSUPPORTSLOCALCOMMUNITIESDURINGTHAILANDVISIT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINUSMARINESBLOWAWAYNSFSCERTIFICATION
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINUSMARINESBLOWAWAYNSFSCERTIFICATION
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINVISITSTHAILANDDURING7THFLEETPATROL
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINVISITSTHAILANDDURING7THFLEETPATROL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINAND7THFLEETORIENTEXPRESSBANDSAILORSBRINGJOYTOLOCALCOMMUNITY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINAND7THFLEETORIENTEXPRESSBANDSAILORSBRINGJOYTOLOCALCOMMUNITY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINARRIVESINISHIKARI
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USSMUSTINARRIVESINISHIKARI
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: VALIANTSHIELDEXERCISEKICKSOFFINPACIFIC
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: VALIANTSHIELDEXERCISEKICKSOFFINPACIFIC
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: VICEADMSCOTTRVANBUSKIRKADDRESSESTHECREWOFUSSMUSTIN(DDG89)DURINGASHIPVISIT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: VICEADMSCOTTRVANBUSKIRKADDRESSESTHECREWOFUSSMUSTIN(DDG89)DURINGASHIPVISIT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: WARFARE TACTICS INSTRUCTORS LEAD USS MUSTIN DURING MULTISAIL 17
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: WARFARE TACTICS INSTRUCTORS LEAD USS MUSTIN DURING MULTISAIL 17
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: WARRIORQUILTSBOOSTMORALEOFMUSTINSAILORSATSEA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: WARRIORQUILTSBOOSTMORALEOFMUSTINSAILORSATSEA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: WELCOMEABOARD
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: WELCOMEABOARD
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO1 06AUG2015 23FEB2017
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO1 06AUG2015 23FEB2017
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO1 13SEPTEMBER2018 2DECEMBER2019
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO1 13SEPTEMBER2018 2DECEMBER2019
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO1 24FEBRUARY2017 13SEPTEMBER2018
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO1 24FEBRUARY2017 13SEPTEMBER2018
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO1 RELIEVED JUNE2012
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO1 RELIEVED JUNE2012
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO1
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO1
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO2 21MARCH2018 9AUGUST2019
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO2 21MARCH2018 9AUGUST2019
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO2 23NOVEMBER2016 20MARCH2018
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO2 23NOVEMBER2016 20MARCH2018
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO2 JULY2015 NOV2016
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO2 JULY2015 NOV2016
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO2
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO2
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO3 11MARCH2017 25MAY2019
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO3 11MARCH2017 25MAY2019
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO3 15JANUARY2015 7AUGUST2016
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO3 15JANUARY2015 7AUGUST2016
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO3 17AUGUST2016 10MARCH2017
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO3 17AUGUST2016 10MARCH2017
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO3 2MAY2012 5JAN2015
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO3 2MAY2012 5JAN2015
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO3 MAY2012 RELIEVED
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO3 MAY2012 RELIEVED
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO3
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: BIO3
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: DEFAULT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: DEFAULT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: FAMILY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: FAMILY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MIDSHIPMENABOARDMUSTIN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MIDSHIPMENABOARDMUSTIN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINDEPARTSMAL
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: MUSTINDEPARTSMAL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: NAMESAKE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: NAMESAKE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: PHOTOS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: PHOTOS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN ARRIVES IN CAMBODIA TO BEGIN CARAT 14
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN ARRIVES IN CAMBODIA TO BEGIN CARAT 14
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN SHARES NAVY LIFE WITH JAPAN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN SHARES NAVY LIFE WITH JAPAN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN VISITS OTARU
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN VISITS OTARU
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN VISITS PYEONGTAEK TO ENHANCE PARTNERSHIPS WITH KOREAN NAVY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89: LAYOUTS: AUTHENTICATE
    2. File: USS MUSTIN VISITS PYEONGTAEK TO ENHANCE PARTNERSHIPS WITH KOREAN NAVY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG89
    2. No filename (redirect)
    3. Title: USS MUSTIN (DDG 89)
    4. No description
    5. No keywords
    6. No extension (redirect)


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO1 09APR2013 24NOV2014
    3. Title: CDR ANTHONY LITTMANN
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO1 09APR2013 24NOV2014
    3. Title: CDR ANTHONY LITTMANN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO1 OCT2011 APR2013
    3. Title: CDR JUSTIN A. KUBU
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO1 OCT2011 APR2013
    3. Title: CDR JUSTIN A. KUBU
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO1 RELIEVEDOCT2011
    3. Title: CDR CHASE PATRICK
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO1 RELIEVEDOCT2011
    3. Title: CDR CHASE PATRICK
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO2 15MARCH2013 23OCT2014
    3. Title: CDR SHEA S. THOMPSON
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO2 15MARCH2013 23OCT2014
    3. Title: CDR SHEA S. THOMPSON
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO2 OCT2011 MAR2012
    3. Title: CDR ANTHONY LITTMANN
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO2 OCT2011 MAR2012
    3. Title: CDR ANTHONY LITTMANN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO2 RELIEVEDOCT2011
    3. Title: CDR JUSTIN KUBU
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO2 RELIEVEDOCT2011
    3. Title: CDR JUSTIN KUBU
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO2
    3. Title: CDR JOSHUA OAKES
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO3 OCT2011 MAR2014
    3. Title: CMDCM MICHAEL LATIMER
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO3 OCT2011 MAR2014
    3. Title: CMDCM MICHAEL LATIMER
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO3 RELIEVEDOCT2011
    3. Title: CMDCM(SW/AW) PAUL A. KING
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO3 RELIEVEDOCT2011
    3. Title: CMDCM(SW/AW) PAUL A. KING
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO3
    3. Title: COMMAND MASTER CHIEF
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BRAZILIAN SCHOOL WELCOMES UNITAS SAILORS DURING COMREL
    3. Title: BRAZILIAN SCHOOL WELCOMES UNITAS SAILORS DURING COMREL
    4. Description: RIO GRANDE, BRAZIL - SAILORS FROM THE USS CHAFEE (DDG 90), USS MCFAUL (DDG 74) AND SAILORS FROM BRAZIL, MEXICO AND CHILE PAINT AT A LOCAL ELEMENTARY SCHOOL IN RIO GRANDE, BRAZIL.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BRAZILIAN SCHOOL WELCOMES UNITAS SAILORS DURING COMREL
    3. Title: BRAZILIAN SCHOOL WELCOMES UNITAS SAILORS DURING COMREL
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: CHAFEE CONDUCTS TRILATERAL PASSEX WITH INDIAN NAVY AND JMSDF IN 7TH FLEET
    3. Title: CHAFEE CONDUCTS TRILATERAL PASSEX WITH INDIAN NAVY AND JMSDF IN 7TH FLEET
    4. Description: USS CHAFEE (DDG 90) PARTICIPATED IN A PASSING EXERCISE (PASSEX) WITH THE INDIAN NAVY SHIPS, INS SATPURA (F48) AND INS KADMATT (P29) AS WELL AS JAPAN MARITIME SELF-DEFENSE FORCE (JMSDF) SHIP JS INAZUMA (DD-105) NOV. 3-6.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: CHAFEE CONDUCTS TRILATERAL PASSEX WITH INDIAN NAVY AND JMSDF IN 7TH FLEET
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: CHAFEERTNS PRLHBR
    3. Title: USS CHAFEE (DDG 90) ARRIVES AT THE JOINT BASE PEARL HARBOR-HICKAM AFTER COMPLETING A THREE-MONTH DEPLOYMENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: CHAFEERTNS PRLHBR
    3. Title: USS CHAFEE RETURNS TO PEARL HARBOR AFTER A THREE-MONTH DEPLOYMENT
    4. Description: PEARL HARBOR (NNS) -- MORE THAN 250 SAILORS ABOARD THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS CHAFEE (DDG 90) RETURNED TO JOINT BASE PEARL HARBOR-HICKAM (JBPHH) AFTER A THREE-MONTH DEPLOYMENT IN THE WESTERN PACIFIC JULY 12
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: CHAFEETORTUGASUPPORT31STMEUATCOBRAGOLD
    3. Title: CHAFEE TORTUGA SUPPORT 31ST MEU AT COBRA GOLD
    4. Description: SATTAHIP, THAILAND - THE GUIDED-MISSILE DESTROYER USS CHAFEE (DDG 90) AND AMPHIBIOUS DOCK LANDING SHIP USS TORTUGA (LSD 46) ARE IN SATTAHIP, THAILAND, SUPPORTING THE 31ST MARINE EXPEDITIONARY UNIT FOR EXERCISE COBRA GOLD 2012 (CG12) FEB. 7-17.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: CHAFEETORTUGASUPPORT31STMEUATCOBRAGOLD
    3. Title: USS CHAFEE (DDG90)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: CHAFEETORETURNHOMEFROMDEPLOYMENT
    3. Title: CHAFEE TO RETURN HOME FROM DEPLOYMENT
    4. Description: PEARL HARBOR - FAMILIES AND FRIENDS WILL WELCOME THE GUIDED-MISSILE DESTROYER USS CHAFEE (DDG 90) HOME TO JOINT BASE PEARL HARBOR-HICKAM JUNE 7, AFTER A SIX-MONTH INDEPENDENT DEPLOYMENT TO THE WESTERN PACIFIC.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: CHAFEETORETURNHOMEFROMDEPLOYMENT
    3. Title: USS CHAFEE (DDG90)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: EXER MALABAR2010
    3. Title: U.S. NAVY PREPARES TO PARTICIPATE IN EXERCISE MALABAR 2010
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: EXER MALABAR2010
    3. Title: U.S. NAVY PREPARES TO PARTICIPATE IN EXERCISE MALABAR 2010
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: FAMILYCRUISE
    3. Title: GUEST ENJOYS FAMILY CRUISE ABOARD CHAFEE
    4. Description: PEARL HARBOR (NNS) -- A GUEST ABOARD USS CHAFEE (DDG 90) STOOD ON THE STARBOARD SIDE OF THE SHIP DURING A SCHEDULED FAMILY CRUISE MARCH 12 WATCHING INTENTLY AS THE SHIP PASSED THE USS ARIZONA MEMORIAL AND "BATTLESHIP ROW"ON ITS WAY OUT OF PEARL HARBOR.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: FAMILYCRUISE
    3. Title: GUEST ENJOYS FAMILY CRUISE ABOARD CHAFEE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: FAMILY
    3. Title: FAMILY - USS CHAFEE
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: KOAKAITRAINSABOVEBELOWANDONSEANEARHAWAII
    3. Title: KOA KAI TRAINS ABOVE, BELOW AND ON SEA NEAR HAWAII
    4. Description: PACIFIC OCEAN - SURFACE NAVY AND OTHER COMBATANT UNITS TOOK PART IN AN INTEGRATED TRAINING ENVIRONMENT CALLED KOA KAI 11-2 IN WATERS SURROUNDING THE HAWAIIAN ISLANDS MARCH 31 TO APRIL 5.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: KOAKAITRAINSABOVEBELOWANDONSEANEARHAWAII
    3. Title: USS CHAFEE (DDG 90) DURING A SMALL BOAT ATTACK EXERCISE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: NAVY IN HAWAII RECOGNIZED IN TWO TOP ENVIRONMENTAL AWARDS
    3. Title: NAVY IN HAWAII RECOGNIZED IN TWO TOP ENVIRONMENTAL AWARDS
    4. Description: TWO HAWAII-BASED NAVY COMMANDS WERE WINNERS OF CHIEF OF NAVAL OPERATIONS ENVIRONMENTAL AWARDS, IT WAS ANNOUNCED YESTERDAY, FEB. 22, IN WASHINGTON D.C.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: NAVY IN HAWAII RECOGNIZED IN TWO TOP ENVIRONMENTAL AWARDS
    3. Title: NAVY IN HAWAII RECOGNIZED IN TWO TOP ENVIRONMENTAL AWARDS
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: NAVYOFFERSHELPFULADVICETOPOLYNESIANVOYAGERS
    3. Title: NAVY OFFERS HELPFUL ADVICE TO POLYNESIAN VOYAGERS
    4. Description: JOINT BASE PEARL HARBOR-HICKAM - "HOKULE'A: HER FARTHEST JOURNEY,"A DOCUMENTARY ABOUT THE POLYNESIAN VOYAGING SOCIETY'S WORLDWIDE VOYAGE NOW UNDERWAY, AIRS FOR THE FIRST TIME TONIGHT AND AGAIN ON LOCAL TV IN HAWAII.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: NAVYOFFERSHELPFULADVICETOPOLYNESIANVOYAGERS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: NEWS ARCHIVE
    3. Title: NEWS ARCHIVE
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: OURSHIP
    3. No title
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: PASTLEADERSHIP
    3. Title: PAST LEADERSHIP
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: SANTAVISITSUSSCHAFEE
    3. Title: SANTA VISITS USS CHAFEE
    4. Description: PEARL HARBOR - SAILORS ABOARD THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS CHAFFEE (DDG 90) SHOW THEIR HOLIDAY SPIRIT DURING THE 2012 HOLIDAY SHIP/SUBMARINE LIGHTING CONTEST.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: SANTAVISITSUSSCHAFEE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: SHIPTOURONBOARDUSSCHAFEE
    3. Title: SHIP TOUR ON BOARD USS CHAFEE
    4. Description: PEARL HARBOR - LT. J.G. JAMI M. TALBOTT, ASSISTANT SUPPLY OFFICER ABOARD THE GUIDED-MISSILE DESTROYER USS CHAFFEE (DDG 90), PROVIDES A TOUR OF THE SHIP TO CAST MEMBERS OF THE TOURING BROADWAY MUSICAL "WICKED".
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: SHIPTOURONBOARDUSSCHAFEE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: STOCKDALEAWARDRECIPIENTSANNOUNCED
    3. Title: STOCKDALE AWARD RECIPIENTS ANNOUNCED
    4. Description: WASHINGTON - FORMER COMMANDING OFFICER OF USS CHAFEE (DDG 90) AND THE CURRENT COMMANDER OF THE USS BOISE (SSN 764) WERE ANNOUNCED AS THE RECIPIENTS OF THE 2012 VICE ADM. JAMES BOND STOCKDALE LEADERSHIP AWARD.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: STOCKDALEAWARDRECIPIENTSANNOUNCED
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: TRILATERALEXERCISETOBECONDUCTEDOFFCOASTOFHAWAIICOMMANDERUSTHIRDFLEETPUBLICAFFAIRS
    3. Title: TRILATERAL EXERCISE TO BE CONDUCTED OFF COAST OF HAWAII
    4. Description: SAN DIEGO, CALIF. - SHIPS OF THE U.S. NAVY, ALONG WITH A CUTTER FROM THE U.S. COAST GUARD ARE CONDUCTING A TRILATERAL EVENT OFF THE COAST OF HAWAII UPON THE CONCLUSION OF THE RIM OF THE PACIFIC (RIMPAC) EXERCISE.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: TRILATERALEXERCISETOBECONDUCTEDOFFCOASTOFHAWAIICOMMANDERUSTHIRDFLEETPUBLICAFFAIRS
    3. Title: TRILATERAL EXERCISE TO BE CONDUCTED OFF COAST OF HAWAII
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: TWO HAWAII BASED NAVY COMMANDS ADVANCE TO WIN SECRETARY OF
    3. Title: TWO HAWAII-BASED NAVY COMMANDS ADVANCE TO WIN SECRETARY OF NAVY ENVIRONMENTAL AWARDS
    4. Description: PACIFIC MISSILE RANGE FACILITY (PMRF) AND THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS CHAFEE (DDG 90) ARE WINNERS OF THE 2015 SECRETARY OF THE NAVY ENVIRONMENTAL AWARD. AWARDEES WERE ANNOUNCED FRIDAY, MARCH 11, 2016 IN WASHINGTON D.C
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: TWO HAWAII BASED NAVY COMMANDS ADVANCE TO WIN SECRETARY OF
    3. Title: AWARD
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USS CHAFEE DEPARTS FOR WESTERN PACIFIC DEPLOYMENT
    3. Title: USS CHAFEE DEPARTS FOR WESTERN PACIFIC DEPLOYMENT
    4. Description: PEARL HARBOR, HAWAII - THE GUIDED-MISSILE DESTROYER USS CHAFEE (DDG 90) IS SCHEDULED TO DEPART JOINT BASE PEARL HARBOR-HICKAM FOR AN INDEPENDENT DEPLOYMENT TO THE WESTERN PACIFIC AND SOUTH AMERICA, JUNE 13.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USS CHAFEE DEPARTS FOR WESTERN PACIFIC DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USS CHAFEE COMPLETES OMSI IN SUPPORT OF MARITIME SECURITY
    3. Title: USS CHAFEE COMPLETES OMSI IN SUPPORT OF MARITIME SECURITY
    4. Description: WESTERN PACIFIC OCEAN -- USS CHAFEE (DDG 90) CONDUCTED AN OCEANIA MARITIME SECURITY INITIATIVE (OMSI) WITH U.S. COAST GUARD’S 14TH DISTRICT, IN THE WESTERN PACIFIC OCEAN.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USS CHAFEE COMPLETES OMSI IN SUPPORT OF MARITIME SECURITY
    3. Title: USS CHAFEE COMPLETES OMSI IN SUPPORT OF MARITIME SECURITY
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USS CHAFEE COMPLETES VOYAGE REPAIR AVAILABILITY IN SINGAPORE
    3. Title: USS CHAFEE COMPLETES VOYAGE REPAIR AVAILABILITY IN SINGAPORE
    4. Description: SINGAPORE (NNS) -- THE GUIDED-MISSILE DESTROYER USS CHAFEE (DDG 90) AND SHIP REPAIR PERSONNEL FROM COMMANDER, LOGISTICS GROUP WESTERN PACIFIC COMPLETED A SUCCESSFUL VOYAGE REPAIR AVAILABILITY IN SINGAPORE, DEC 16.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USS CHAFEE COMPLETES VOYAGE REPAIR AVAILABILITY IN SINGAPORE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USS CHAFEE SAILORS EXPERIENCE RICH BRISBANE CULTURE
    3. Title: USS CHAFEE SAILORS EXPERIENCE RICH BRISBANE CULTURE
    4. Description: BRISBANE, AUSTRALIA -- THE USS CHAFEE (DDG 90) VISITED BRISBANE, FOR A PORT VISIT AND PREPARED FOR EXERCISE TALISMAN SABRE 2015.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USS CHAFEE SAILORS EXPERIENCE RICH BRISBANE CULTURE
    3. Title: USS CHAFEE SAILORS EXPERIENCE RICH BRISBANE CULTURE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USS CHAFEE TO DEPART ON DEPLOYMENT
    3. Title: USS CHAFEE DEPARTED FOR DEPLOYMENT
    4. Description: PEARL HARBOR-HICKAM – THE GUIDED-MISSILE DESTROYER USS CHAFEE (DDG 90) IS SCHEDULED TO DEPART ON AN INDEPENDENT DEPLOYMENT TO THE U.S. 7TH AND 4TH FLEET AREAS OF OPERATIONS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USS CHAFEE TO DEPART ON DEPLOYMENT
    3. Title: USS CHAFEE DEPARTED FOR DEPLOYMENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USS CHAFEE PARTICIPATES IN MULTILATERAL MIO EXERCISE
    3. Title: USS CHAFEE PARTICIPATES IN MULTILATERAL MIO EXERCISE
    4. Description: USS CHAFEE (DDG 90) WILL JOIN SHIPS FROM THE REPUBLIC OF KOREA NAVY AND THE ROYAL AUSTRALIAN NAVY DURING A MULTILATERAL MARITIME INTERDICTION OPERATIONS (MIO) EXERCISE IN WATERS OFF THE COAST OF THE REPUBLIC OF KOREA, NOV. 6-7.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USS CHAFEE PARTICIPATES IN MULTILATERAL MIO EXERCISE
    3. Title: DDG90
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USS CHAFEE TO RETURN HOME FROM INDEPENDENT DEPLOYMENT
    3. Title: USS CHAFEE TO RETURN HOME FROM INDEPENDENT DEPLOYMENT
    4. Description: JOINT BASE PEARL HARBOR-HICKAM - THE GUIDED-MISSILE DESTROYER USS CHAFEE (DDG 90) IS SCHEDULED TO RETURN HOME FROM AN INDEPENDENT DEPLOYMENT TO THE U.S. 3RD, 4TH AND 7TH FLEET AREAS OF OPERATIONS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USS CHAFEE TO RETURN HOME FROM INDEPENDENT DEPLOYMENT
    3. Title: USS CHAFEE TO RETURN HOME FROM INDEPENDENT DEPLOYMENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USSCHAFEEARRIVESINDARWINAUSTRALIA
    3. Title: USS CHAFEE ARRIVES IN DARWIN, AUSTRALIA
    4. Description: DARWIN, AUSTRALIA – GUIDED-MISSILE DESTROYER USS CHAFEE (DDG 90) ARRIVED IN DARWIN, AUSTRALIA ON FEB. 17 FOR A PORT VISIT AS PART OF THE COMMEMORATION CEREMONIES REMEMBERING THE 70TH ANNIVERSARY OF THE BOMBING OF DARWIN DURING WORLD WAR II.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USSCHAFEEARRIVESINDARWINAUSTRALIA
    3. Title: MORE PHOTOS
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USSCHAFEE(DDG90)HONORSVETERNSDAY
    3. Title: SENIOR CHIEF OPERATIONS SPECIALIST DOUGLAS ANDERSON, PLACES AN AMERICAN FLAG AT A HEADSTONE AT THE OAHU CEMETERY IN HONOLULU.
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USSCHAFEE(DDG90)HONORSVETERNSDAY
    3. Title: USS CHAFEE (DDG 90) HONORS VETERAN'S DAY
    4. Description: HONOLULU (NOV. 9, 2010) - SENIOR CHIEF OPERATIONS SPECIALIST DOUGLAS ANDERSON, ASSIGNED TO THE GUIDED-MISSILE DESTROYER USS CHAFEE (DDG 90), PLACES AN AMERICAN FLAG AT A HEADSTONE AT THE OAHU CEMETERY IN HONOLULU.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USSCHAFEEARRIVESINILOILOPHILIPPINES
    3. Title: USS CHAFEE ARRIVES IN ILOILO, PHILIPPINES
    4. Description: ILOILO, REPUBLIC OF THE PHILIPPINES – GUIDED-MISSILE DESTROYER USS CHAFEE (DDG 90) ARRIVED IN ILOILO, REPUBLIC OF THE PHILIPPINES ON MARCH 2, FOR A PORT VISIT AND TO PARTICIPATE IN THE U.S. STATE DEPARTMENT PROGRAM, AMERICA IN 3D.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USSCHAFEEARRIVESINILOILOPHILIPPINES
    3. Title: USS CHAFEE SAILORS PARTICIPATE IN COLOR GUARD PRESENTATION
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USSCHAFEEDEPARTSILOILOPHILIPPINES
    3. Title: LT.J.G. KARI WENIGER (LEFT) WATCHES TWO SAILORS CONDUCT COLORS WHILE IN PORT ILOILO
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USSCHAFEEDEPARTSILOILOPHILIPPINES
    3. Title: USS CHAFEE DEPARTS ILOILO, PHILIPPINES
    4. Description: ILOILO, REPUBLIC OF THE PHILIPPINES – THE GUIDED-MISSILE DESTROYER USS CHAFEE (DDG 90) DEPARTED ILOILO, REPUBLIC OF THE PHILIPPINES MAR. 5, AFTER A PORT VISIT TO SUPPORT THE U.S. STATE DEPARTMENT PROGRAM “AMERICA IN 3D”.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USSCHAFEESAILORDEMONSTRATESSEARCHANDRESCUETECHNIQUESTOVIETNAMESENAVY
    3. Title: USS CHAFEE PARTICIPATES IN NAVY EXCHANGE ACTIVITY (NEA) VIETNAM
    4. Description: DA NANG, VIETNAM - OPERATIONS SPECIALIST 3RD CLASS ZACHERY CRAIG DEMONSTRATES SEARCH AND RESCUE PLOTTING TECHNIQUES TO VIETNAMESE PEOPLE'S NAVY OFFICERS ABOARD THE GUIDED-MISSILE DESTROYER USS CHAFEE (DDG 90).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USSCHAFEESAILORDEMONSTRATESSEARCHANDRESCUETECHNIQUESTOVIETNAMESENAVY
    3. Title: USS CHAFEE SAILOR DEMONSTRATES SEARCH AND RESCUE TECHNIQUES TO VIETNAMESE NAVY.
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USSCHAFEETAKESONBIOFUEL
    3. Title: USS CHAFEE TAKES ON BIOFUEL
    4. Description: PACIFIC OCEAN - THE GUIDED-MISSILE DESTROYER USS CHAFEE (DDG 90) TOOK ON 250,000 GALLONS OF ALTERNATIVE FUEL, A 50/50 BLEND OF ADVANCED BIOFUEL AND TRADITIONAL PETROLEUM-BASED FUEL, FROM THE FLEET REPLENISHMENT OILER USNS HENRY J. KAISER.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USSCHAFEETAKESONBIOFUEL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USSCHAFEEHOLDSCHANGEOFCOMMAND
    3. Title: USS CHAFEE HOLDS CHANGE OF COMMAND
    4. Description: CMDR. ANTHONY C. LITTMANN RELIEVED CMDR. JUSTIN A. KUBU AS COMMANDING OFFICER OF USS CHAFEE (DDG 90) DURING A CHANGE OF COMMAND CEREMONY HELD AT PEARL HARBOR, HAWAII.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USSCHAFEEHOLDSCHANGEOFCOMMAND
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USSCHAFEEISADOPTEDFORCHRISTMAS
    3. Title: USS CHAFEE IS ADOPTED FOR CHRISTMAS
    4. Description: USS CHAFEE, PEARL HARBOR, HI - SPARKLING LIGHTS AND DAZZLING DECORATIONS DAWN MOST OF THE SHIPS ON THE PEARL HARBOR WATERFRONT THIS TIME OF YEAR, BUT ONE SHIP HAS TAKEN THE SPIRIT OF THE SEASON TO A WHOLE NEW LEVEL.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USSCHAFEEISADOPTEDFORCHRISTMAS
    3. Title: USS CHAFEE IS ADOPTED FOR CHRISTMAS
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USSCHAFEETODEPLOYTOWESTERNPACIFIC
    3. Title: USS CHAFEE (DDG 90)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USSCHAFEETODEPLOYTOWESTERNPACIFIC
    3. Title: USS CHAFEE TO DEPLOY TO WESTERN PACIFIC
    4. Description: PEARL HARBOR - GUIDED-MISSILE DESTROYER USS CHAFEE (DDG 90) WILL DEPART JOINT BASE PEARL HARBOR-HICKAM ON NOV. 29, FOR AN INDEPENDENT DEPLOYMENT TO THE WESTERN PACIFIC.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USSCHAFEEUNDERWAYINTHEUS7THFLEETAREAOFRESPONSIBILITY
    3. Title: USS CHAFEE UNDERWAY IN THE U.S. 7TH FLEET AREA OF RESPONSIBILITY.
    4. Description: SOUTH CHINA SEA - ENS CHRISTOPHER VEENHUIS, LEFT, CDR JUSTIN KUBU, LTJG GEORGES BANKS AND LT RICK ZABAWA RENDER HONORS ABOARD THE GUIDED-MISSILE DESTROYER USS CHAFEE, AFTER COMPLETING A PASSING EXERCISE.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USSCHAFEEUNDERWAYINTHEUS7THFLEETAREAOFRESPONSIBILITY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: ALONGSIDEUSNSALANSHEPARD
    3. Title: USS CHAFEE TAKES ON FUEL ALONG SIDE USNS ALAN SHEPARD WHILE TRANSITING THE SOUTH CHINA SEA.
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: ALONGSIDEUSNSALANSHEPARD
    3. Title: USS CHAFEE TAKES ON FUEL ALONG SIDE USNS ALAN SHEPARD WHILE TRANSITING THE SOUTH CHINA SEA.
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO1 14DECEMBER2018 24APRIL2020
    3. Title: (DECEMBER 14, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO1 14DECEMBER2018 24APRIL2020
    3. Title: CDR ANDREW P. RIVAS
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO1 25NOVEMBER2014 29APRIL2016
    3. Title: ( NOVEMBER 2014 - APRIL 2016)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO1 25NOVEMBER2014 29APRIL2016
    3. Title: CDR SHEA S. THOMPSON
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO1 28AUGUST2017 13DECEMBER2018
    3. Title: AUGUST 28, 2017 - PRESENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO1 28AUGUST2017 13DECEMBER2018
    3. Title: CDR JACOB BRAUN
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO1 30APRIL2016 28AUGUST2017
    3. Title: (APRIL 30, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO1 30APRIL2016 28AUGUST2017
    3. Title: CDR BRIAN FREMMING
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO1
    3. Title: (APRIL 25, 2020 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO1
    3. Title: CDR SHANE DENNIS
    4. Description: CDR SHANE DENNIS
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO2 14DECEMBER2018 25APRIL2019
    3. Title: (DECEMBER 14, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO2 14DECEMBER2018 25APRIL2019
    3. Title: EXECUTIVE OFFICER
    4. Description: CDR JOHN CULPEPPER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO2 1APRIL2016 1DECEMBER2017
    3. Title: (APRIL 1, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO2 1APRIL2016 1DECEMBER2017
    3. Title: CDR MATTHEW MCKENNA
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO2 24OCT2014 31MAR2016
    3. Title: CDR BRIAN FREMMING
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO2 24OCT2014 31MAR2016
    3. Title: EXECUTIVE OFFICER (OCTOBER 2014 - MARCH 2016)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO2
    3. Title: (APRIL 26, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO2
    3. Title: CDR JOSHUA OAKES
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO3 3JUNE2016 14MAY2019
    3. Title: COMMAND MASTER CHIEF
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO3 3JUNE2016 14MAY2019
    3. Title: DDG-90
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO3 MAR2014 JUNE2016
    3. Title: CMDCM(SW/IDW) PATRICK A. TUMMINS
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO3 MAR2014 JUNE2016
    3. Title: COMMAND MASTER CHIEF (MARCH 2014 - JUNE 2016)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO3
    3. Title: (MAY 15, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: BIO3
    3. Title: COMMAND MASTER CHIEF
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: CHAFEERETURNSHOME
    3. Title: USS CHAFEE RETURNS HOME TO PEARL HARBOR
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: CHAFEERETURNSHOME
    3. Title: USS CHAFEE RETURNS HOME TO PEARL HARBOR
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: CHAFEESAILORSREFLECT
    3. Title: SAILORS REFLECT, HONOR VETERANS AT OAHU CEMETERY
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: CHAFEESAILORSREFLECT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: DEFAULT
    3. Title: USS CHAFEE (DDG 90)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: DEFAULT
    3. Title: USS CHAFEE (DDG 90)
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: FUN
    3. Title: FOR FUN
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: HAWAII SHIPS SHORE LEADING IN LED ING FOR ENERGY SECURITY
    3. Title: HAWAII SHIPS, SHORE LEADING IN 'LED-ING'FOR ENERGY SECURITY
    4. Description: PEARL HARBOR (NNS) -- AS EARTH MONTH CONTINUES, THE NAVY IN HAWAII CONDUCTED THE SECOND INSTALLMENT OF EARTH DAY THEMED INTERVIEW SEGMENTS TO HIGHLIGHT ENERGY CONSERVATION AT SHORE INSTALLATIONS AND AT SEA.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: HAWAII SHIPS SHORE LEADING IN LED ING FOR ENERGY SECURITY
    3. Title: HAWAII SHIPS, SHORE LEADING IN LED-ING FOR ENERGY SECURITY
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: NAMESAKE
    3. Title: NAMED AFTER JOHN LESTER HUBBARD CHAFEE
    4. Description: THOUGH THE CURRENT USS CHAFEE WAS NAMED FOR JOHN LESTER HUBBARD CHAFEE, THE FIRST USS CHAFEE (DE 230) WAS NAMED AFTER ENS DAVIS ELLIOTT CHAFEE.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: OURSHIP
    3. Title: ABOUT US
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: SPECS
    3. Title: SHIP SPECS
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USS CHAFEE HOLDS CHANGE OF COMMAND AT JBPHH
    3. Title: USS CHAFEE HOLDS CHANGE OF COMMAND AT JBPHH
    4. Description: PEARL HARBOR - CMDR. SHEA S. THOMPSON RELIEVED CMDR. ANTHONY LITTMANN AS COMMANDING OFFICER OF THE GUIDED-MISSILE DESTROYER USS CHAFEE (DDG 90) DURING A CHANGE OF COMMAND CEREMONY HELD PIERSIDE AT JOINT BASE PEARL HARBOR-HICKAM.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USS CHAFEE HOLDS CHANGE OF COMMAND AT JBPHH
    3. Title: USS CHAFEE HOLDS CHANGE OF COMMAND AT JBPHH
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USS CHAFEE PARTICIPATES IN FESTIVAL OF LIGHTS
    3. Title: USS CHAFEE PARTICIPATES IN FESTIVAL OF LIGHTS
    4. Description: PEARL HARBOR - THE GUIDED-MISSILE DESTROYER USS CHAFEE (DDG 90) DISPLAYS ITS HOLIDAY LIGHTS AT JOINT BASE PEARL HARBOR-HICKAM.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: USS CHAFEE PARTICIPATES IN FESTIVAL OF LIGHTS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: VISITSKOTAKINABALU MALAYSIA
    3. Title: USS CHAFEE (DDG 90) VISITS KOTA KINABALU, MALAYSIA
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: VISITSKOTAKINABALU MALAYSIA
    3. Title: USS CHAFEE (DDG 90) VISITS KOTA KINABALU, MALAYSIA
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PAGES
    2. File: WELCOME
    3. Title: WELCOME ABOARD
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: PHOTOS
    2. File: 100712 N 0464S HOMECOMING
    3. Title: USS CHAFEE (DDG 90) ARRIVES AT THE JOINT BASE PEARL HARBOR-HICKAM AFTER COMPLETING A THREE-MONTH DEPLOYMENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PHOTOS
    2. File: 120302 N ZZ999 013
    3. Title: LT.J.G. KARI WENIGER (LEFT) WATCHES TWO SAILORS CONDUCT COLORS WHILE IN PORT ILOILO
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PHOTOS
    2. File: 120302 N ZZ999 015
    3. Title: USS CHAFEE SAILORS PARTICIPATE IN COLOR GUARD PRESENTATION
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PHOTOS
    2. File: 120424 N LX503 001
    3. Title: USS CHAFEE SAILOR DEMONSTRATES SEARCH AND RESCUE TECHNIQUES TO VIETNAMESE NAVY.
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PHOTOS
    2. File: 5577906665 D7E8B285BE Z
    3. Title: USS CHAFEE (DDG 90) DURING A SMALL BOAT ATTACK EXERCISE
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PHOTOS
    2. File: 6 11 2010 12 55 38 MALAYSIAN ORPHANAGE2010
    3. Title: CHAFEE SAILORS PARTICIPATED IN A COMMUNITY SERVICE AND RELATIONS PROJECT, BRINGING JOY TO LOCAL MALAYSIAN ORPHANS IN THE CITY
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG90: PHOTOS
    2. File: 6 11 2010 12 56 31 WHITEH2O RAFTING MALAYSIA
    3. Title: RIVER RAFTING IN KOTA KINABALU, MALAYSIA
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG90: PHOTOS
    2. File: PICTURE083 REFUELING SOUTHCHINASEA2010
    3. Title: USS CHAFEE TAKES ON FUEL ALONG SIDE USNS ALAN SHEPARD WHILE TRANSITING THE SOUTH CHINA SEA.
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PHOTOS
    2. File: WEB 101109 N 3666S 027
    3. Title: SENIOR CHIEF OPERATIONS SPECIALIST DOUGLAS ANDERSON, PLACES AN AMERICAN FLAG AT A HEADSTONE AT THE OAHU CEMETERY IN HONOLULU.
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PHOTOS
    2. File: WEB 120105 N ZZ999 013
    3. Title: ADM. JONATHAN GREENERT DELIVERS REMARKS DURING THE 31ST ANNUAL VICE ADMIRAL JAMES BOND STOCKDALE LEADERSHIP AWARD CEREMONY.
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PHOTOS
    2. File: WEB 120718 N AC887 004
    3. Title: LT. J.G. K. SMITH EXPLAINS ENERGY-EFFICIENT SYSTEMS ABOARD USS CHAFEE TO SECRETARY OF THE NAVY (SECNAV) THE HONORABLE RAY MABUS
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CDR BRAUN SMALL
    3. Title: AUGUST 28, 2017 - PRESENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CDR BRAUN
    3. Title: AUGUST 28, 2017 - PRESENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CDR CULPEPPER XO SMALL
    3. Title: (DECEMBER 14, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CDR CULPEPPER XO
    3. Title: (DECEMBER 14, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: BMP


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CDR RIVAS CO SMALL
    3. Title: (DECEMBER 14, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CDR RIVAS CO
    3. Title: (DECEMBER 14, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CHAFEE
    3. Title: DESTROYER
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CMC LATIMER
    3. Title: CMDCM MICHAEL LATIMER
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CMC TUMMIN SMALL
    3. Title: COMMAND MASTER CHIEF (MARCH 2014 - JUNE 2016)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CMC TUMMIN
    3. Title: COMMAND MASTER CHIEF (MARCH 2014 - JUNE 2016)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CMC
    3. Title: CMDCM(SW/AW) PAUL A. KING
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CO KUBU
    3. Title: CDR JUSTIN A. KUBU
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CO LITTMANN SMALL
    3. Title: CDR ANTHONY LITTMANN
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CO THOMPSON SMALL
    3. Title: ( NOVEMBER 2014 - APRIL 2016)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: JOHNCHAFEEFAMILY
    3. Title: CHAFEE FAMILY
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: JOHNCHAFEE
    3. Title: JOHN CHAFEE
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: USN SPOKANE TROPHY 2004
    3. Title: TROPHY
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: USSCHAFEEUNDERWAY FEB3
    3. Title: USS CHAFEE UNDERWAY
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: XO FREMMING
    3. Title: EXECUTIVE OFFICER (OCTOBER 2014 - MARCH 2016)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: XO LITTMANN
    3. Title: CDR ANTHONY LITTMANN
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: XO THOMPSON SMALL
    3. Title: CDR SHEA S. THOMPSON
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CDRFREMMING
    3. Title: (APRIL 30, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CHAFEE CO
    3. Title: CDR CHASE PATRICK
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CHAFEE XO
    3. Title: CDR JUSTIN KUBU
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CHAFEE62 3
    3. Title: JOHN CHAFEE
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CHAFEECREW
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CHAFEEFAMILIES
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CMC ENCINAS SMALL
    3. Title: (MAY 15, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CMC ENCINAS
    3. Title: (MAY 15, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CMC PREBEG SMALL
    3. Title: DDG-90
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: CMC PREBEG
    3. Title: DDG-90
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: DDG90 CHAFEE
    3. Title: USS CHAFEE
    4. No description
    5. No keywords
    6. Extension: GIF


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: LCDR OAKES WHITE SMALL
    3. Title: (APRIL 26, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: LCDR OAKES WHITE
    3. Title: (APRIL 26, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: MR CHAFEE
    3. Title: JOHN CHAFEE
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: XO DENNIS SMALL
    3. Title: (APRIL 25, 2020 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: XO DENNIS
    3. Title: (APRIL 25, 2020 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: XO MCKENNA SMALL
    3. Title: (APRIL 1, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: PUBLISHINGIMAGES
    2. File: XO MCKENNA
    3. Title: (APRIL 1, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO1 09APR2013 24NOV2014
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO1 09APR2013 24NOV2014
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO1 OCT2011 APR2013
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO1 OCT2011 APR2013
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO1 RELIEVEDOCT2011
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO1 RELIEVEDOCT2011
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO2 15MARCH2013 23OCT2014
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO2 15MARCH2013 23OCT2014
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO2 OCT2011 MAR2012
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO2 OCT2011 MAR2012
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO2 RELIEVEDOCT2011
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO2 RELIEVEDOCT2011
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO2
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO2
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO3 OCT2011 MAR2014
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO3 OCT2011 MAR2014
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO3 RELIEVEDOCT2011
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO3 RELIEVEDOCT2011
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO3
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO3
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BRAZILIAN SCHOOL WELCOMES UNITAS SAILORS DURING COMREL
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BRAZILIAN SCHOOL WELCOMES UNITAS SAILORS DURING COMREL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: CHAFEE CONDUCTS TRILATERAL PASSEX WITH INDIAN NAVY AND JMSDF IN 7TH FLEET
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: CHAFEE CONDUCTS TRILATERAL PASSEX WITH INDIAN NAVY AND JMSDF IN 7TH FLEET
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: CHAFEERTNS PRLHBR
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: CHAFEERTNS PRLHBR
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: CHAFEETORTUGASUPPORT31STMEUATCOBRAGOLD
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: CHAFEETORTUGASUPPORT31STMEUATCOBRAGOLD
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: CHAFEETORETURNHOMEFROMDEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: CHAFEETORETURNHOMEFROMDEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: EXER MALABAR2010
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: EXER MALABAR2010
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: FAMILYCRUISE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: FAMILYCRUISE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: FAMILY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: FAMILY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: KOAKAITRAINSABOVEBELOWANDONSEANEARHAWAII
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: KOAKAITRAINSABOVEBELOWANDONSEANEARHAWAII
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: NAVY IN HAWAII RECOGNIZED IN TWO TOP ENVIRONMENTAL AWARDS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: NAVY IN HAWAII RECOGNIZED IN TWO TOP ENVIRONMENTAL AWARDS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: NAVYOFFERSHELPFULADVICETOPOLYNESIANVOYAGERS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: NAVYOFFERSHELPFULADVICETOPOLYNESIANVOYAGERS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: NEWS ARCHIVE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: NEWS ARCHIVE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: PASTLEADERSHIP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: PASTLEADERSHIP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: SANTAVISITSUSSCHAFEE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: SANTAVISITSUSSCHAFEE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: SHIPTOURONBOARDUSSCHAFEE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: SHIPTOURONBOARDUSSCHAFEE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: STOCKDALEAWARDRECIPIENTSANNOUNCED
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: STOCKDALEAWARDRECIPIENTSANNOUNCED
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: TRILATERALEXERCISETOBECONDUCTEDOFFCOASTOFHAWAIICOMMANDERUSTHIRDFLEETPUBLICAFFAIRS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: TRILATERALEXERCISETOBECONDUCTEDOFFCOASTOFHAWAIICOMMANDERUSTHIRDFLEETPUBLICAFFAIRS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: TWO HAWAII BASED NAVY COMMANDS ADVANCE TO WIN SECRETARY OF
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: TWO HAWAII BASED NAVY COMMANDS ADVANCE TO WIN SECRETARY OF
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USS CHAFEE DEPARTS FOR WESTERN PACIFIC DEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USS CHAFEE DEPARTS FOR WESTERN PACIFIC DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USS CHAFEE COMPLETES OMSI IN SUPPORT OF MARITIME SECURITY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USS CHAFEE COMPLETES OMSI IN SUPPORT OF MARITIME SECURITY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USS CHAFEE COMPLETES VOYAGE REPAIR AVAILABILITY IN SINGAPORE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USS CHAFEE COMPLETES VOYAGE REPAIR AVAILABILITY IN SINGAPORE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USS CHAFEE SAILORS EXPERIENCE RICH BRISBANE CULTURE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USS CHAFEE SAILORS EXPERIENCE RICH BRISBANE CULTURE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USS CHAFEE TO DEPART ON DEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USS CHAFEE TO DEPART ON DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USS CHAFEE PARTICIPATES IN MULTILATERAL MIO EXERCISE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USS CHAFEE PARTICIPATES IN MULTILATERAL MIO EXERCISE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USS CHAFEE TO RETURN HOME FROM INDEPENDENT DEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USS CHAFEE TO RETURN HOME FROM INDEPENDENT DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USSCHAFEEARRIVESINDARWINAUSTRALIA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USSCHAFEEARRIVESINDARWINAUSTRALIA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USSCHAFEE(DDG90)HONORSVETERNSDAY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USSCHAFEE(DDG90)HONORSVETERNSDAY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USSCHAFEEARRIVESINILOILOPHILIPPINES
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USSCHAFEEARRIVESINILOILOPHILIPPINES
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USSCHAFEEDEPARTSILOILOPHILIPPINES
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USSCHAFEEDEPARTSILOILOPHILIPPINES
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USSCHAFEESAILORDEMONSTRATESSEARCHANDRESCUETECHNIQUESTOVIETNAMESENAVY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USSCHAFEESAILORDEMONSTRATESSEARCHANDRESCUETECHNIQUESTOVIETNAMESENAVY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USSCHAFEETAKESONBIOFUEL
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USSCHAFEETAKESONBIOFUEL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USSCHAFEEHOLDSCHANGEOFCOMMAND
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USSCHAFEEHOLDSCHANGEOFCOMMAND
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USSCHAFEEISADOPTEDFORCHRISTMAS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USSCHAFEEISADOPTEDFORCHRISTMAS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USSCHAFEETODEPLOYTOWESTERNPACIFIC
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USSCHAFEETODEPLOYTOWESTERNPACIFIC
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USSCHAFEEUNDERWAYINTHEUS7THFLEETAREAOFRESPONSIBILITY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USSCHAFEEUNDERWAYINTHEUS7THFLEETAREAOFRESPONSIBILITY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: ALONGSIDEUSNSALANSHEPARD
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: ALONGSIDEUSNSALANSHEPARD
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO1 14DECEMBER2018 24APRIL2020
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO1 14DECEMBER2018 24APRIL2020
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO1 25NOVEMBER2014 29APRIL2016
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO1 25NOVEMBER2014 29APRIL2016
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO1 28AUGUST2017 13DECEMBER2018
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO1 28AUGUST2017 13DECEMBER2018
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO1 30APRIL2016 28AUGUST2017
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO1 30APRIL2016 28AUGUST2017
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO1
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO1
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO2 14DECEMBER2018 25APRIL2019
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO2 14DECEMBER2018 25APRIL2019
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO2 1APRIL2016 1DECEMBER2017
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO2 1APRIL2016 1DECEMBER2017
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO2 24OCT2014 31MAR2016
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO2 24OCT2014 31MAR2016
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO2
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO2
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO3 3JUNE2016 14MAY2019
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO3 3JUNE2016 14MAY2019
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO3 MAR2014 JUNE2016
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO3 MAR2014 JUNE2016
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO3
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: BIO3
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: CHAFEERETURNSHOME
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: CHAFEERETURNSHOME
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: CHAFEESAILORSREFLECT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: CHAFEESAILORSREFLECT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: DEFAULT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: DEFAULT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: FUN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: FUN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: HAWAII SHIPS SHORE LEADING IN LED ING FOR ENERGY SECURITY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: HAWAII SHIPS SHORE LEADING IN LED ING FOR ENERGY SECURITY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: NAMESAKE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: NAMESAKE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: SPECS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: SPECS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USS CHAFEE HOLDS CHANGE OF COMMAND AT JBPHH
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USS CHAFEE HOLDS CHANGE OF COMMAND AT JBPHH
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USS CHAFEE PARTICIPATES IN FESTIVAL OF LIGHTS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: USS CHAFEE PARTICIPATES IN FESTIVAL OF LIGHTS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: VISITSKOTAKINABALU MALAYSIA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: VISITSKOTAKINABALU MALAYSIA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: WELCOME
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90: LAYOUTS: AUTHENTICATE
    2. File: WELCOME
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG90
    2. No filename (redirect)
    3. Title: USS CHAFEE
    4. No description
    5. No keywords
    6. No extension (redirect)


    1. Path: SURFOR: DDG91: PAGES
    2. File: 7THFLEETADJUSTSEFFORTSINSUPPORTOFMH370SEARCH
    3. Title: 7TH FLEET ADJUSTS EFFORTS IN SUPPORT OF MH370 SEARCH
    4. Description: PEARL HARBOR, HAWAII - USS KIDD (DDG 100) WILL PROCEED TO THE STRAIT OF MALACCA TO CONTINUE ITS ASSISTANCE WITH THE SEARCH FOR MISSING MALAYSIA AIRLINES FLIGHT MH370 AND A U.S. NAVY P-8A POSEIDON WILL JOIN THE EFFORT LATER THIS WEEK, U.S. 7TH FLEET.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: 7THFLEETADJUSTSEFFORTSINSUPPORTOFMH370SEARCH
    3. Title: 7TH FLEET ADJUSTS EFFORTS IN SUPPORT OF MH370 SEARCH
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: ANNUALPHYSICALHEALTHASSESSMENT(PHA)
    3. Title: ANNUAL PHYSICAL HEALTH ASSESSMENT (PHA)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: ANNUALPHYSICALHEALTHASSESSMENT(PHA)
    3. Title: PINCKNEY SAILORS CONDUCT ANNUAL PHYSICAL HEALTH ASSESSMENT (PHA)
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO1 27AUG2016 25JAN2018
    3. Title: AUGSUT 27, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO1 27AUG2016 25JAN2018
    3. Title: CDR FRANK WALTER
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO1 APR2012 SEP2013
    3. Title: COMMANDER B. R. NICHOLSON
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO1 APR2012 SEP2013
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO1
    3. Title: CDR ANDREW ROY
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO2 APR2012 SEP2013
    3. Title: COMMANDER FRANK E. OKATA
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO2 APR2012 SEP2013
    3. Title: EXECUTIVE OFFICER (4/15/2012 - 9/5/2013)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO2 RELIEVEDSEP2011
    3. Title: COMMANDER TURHAN HIDALGO
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO2 RELIEVEDSEP2011
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO3 DEC2010 25FEB2013
    3. Title: CMDCM(SW/AW) CLARO D. MUNAR
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO3 DEC2010 25FEB2013
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BOATSWAINSMATESEAMANVICTORHERNANDEZABOARD
    3. Title: SAILORS SPREAD CHEER AT SINGAPORE SCHOOL
    4. Description: BOATSWAIN'S MATE SEAMAN VICTOR HERNANDEZ, FROM BALDWIN PARK, CALIF., READS TO PRE-SCHOOL CHILDREN AT THE INTERNATIONAL COMMUNITY SCHOOL SINGAPORE DURING A COMMUNITY SERVICE PROJECT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BOATSWAINSMATESEAMANVICTORHERNANDEZABOARD
    3. Title: USS PINCKNEY (DDG 91) BOATSWAINS MATE SEAMAN VICTOR HERNANDEZ IN COMMUNITY SERVICE ROLE IN SINGAPORE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: COMLOGWESTPACHOLDSALLHANDSCALLABOARDPINCKNEY
    3. Title: COMLOG WESTPAC HOLDS ALL HANDS CALL ABOARD PINCKNEY
    4. Description: SINGAPORE - REAR ADM. CINDY THEBUAD, COMMANDER, LOGISTICS GROUP WESTERN PACIFIC CONDUCTED AN ALL HANDS CALL ABOARD THE ARLEIGH BURKE-CLASS GUIDED MISSILE DESTROYER USS PINCKNEY (DDG 91) AT CHANGI NAVAL BASE IN SINGAPORE.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: COMLOGWESTPACHOLDSALLHANDSCALLABOARDPINCKNEY
    3. Title: COMLOG WESTPAC HOLDS ALL HANDS CALL ABOARD PINCKNEY
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: CALIFORNIA BASEDSAILORSCLEANUPBEACHFOREARTHDAY
    3. Title: CALIFORNIA-BASED SAILORS CLEAN UP BEACH FOR EARTH DAY
    4. Description: VENTURA, CALIF. - SAILORS ASSIGNED TO THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS PINCKNEY (DDG 91) CONDUCT AN EARTH DAY BEACH CLEAN UP.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: CALIFORNIA BASEDSAILORSCLEANUPBEACHFOREARTHDAY
    3. Title: SAILORS ASSIGNED TO USS PINCKNEY PARTICIPATE IN BEACH CLEAN UP.
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: DDG93 MK45
    3. Title: USS PINCKNEY DDG93 MK-45 SHOT
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: DDG93 MK45
    3. Title: USS PINCKNEY PACFIRE TRAINING EXERCISE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: FAMILY
    3. Title: FAMILY - USS PINCKNEY
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: MIDSHIPMENJOINPINCKNEYCREWFORUNDERWAYREPLENISHMENT
    3. Title: MIDSHIPMEN JOIN PINCKNEY CREW FOR UNDERWAY REPLENISHMENT
    4. Description: PACIFIC OCEAN - THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS PINCKNEY (DDG 91) WELCOMED 19 MIDSHIPMEN, FROM VARIOUS ROTC PROGRAMS AS WELL AS THE U.S. NAVAL ACADEMY, ON BOARD THE SHIP THE FIRST PART OF AUGUST AS PART OF THEIR SUMMER TRAINING CRUISE.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: MIDSHIPMENJOINPINCKNEYCREWFORUNDERWAYREPLENISHMENT
    3. Title: MIDSHIPMEN JOIN PINCKNEY CREW FOR UNDERWAY REPLENISHMENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: NEWS ARCHIVE
    3. Title: NEWS ARCHIVE
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: OURSHIP
    3. No title
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: PARADEOFSHIPSMAKESGRANDENTRANCEDURINGSANFRANCISCOFLEETWEEK
    3. Title: SHIPS ARE GRAND ENTRANCE AT SAN FRANCISCO FLEET WEEK
    4. Description: SAN FRANCISCO (OCT. 9, 2010) THE GUIDED-MISSILE DESTROYER USS PINCKNEY (DDG 91) PASSES UNDER THE GOLDEN GATE BRIDGE DURING THE PARADE OF SHIPS AT SAN FRANCISCO FLEET WEEK 2010.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: PARADEOFSHIPSMAKESGRANDENTRANCEDURINGSANFRANCISCOFLEETWEEK
    3. Title: USS PINCKNEY PARTICIPATES IN SAN FRANCISCO FLEET WEEK 2010
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: PASTLEADERSHIP
    3. Title: PAST LEADERSHIP
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: PINCKNEYMEDICALTEAMTREATSINJUREDCIVILIANONMERCHANTVESSEL
    3. Title: PINCKNEY MEDICAL TEAM TREATS INJURED CIVILIAN ON MERCHANT VESSEL
    4. Description: GULF OF ADEN - THREE MEDICAL PERSONNEL ASSIGNED TO EXPEDITIONARY RESUSCITATIVE SURGICAL SYSTEM (ERSS) 7, EMBARKED ABOARD GUIDED-MISSILE DESTROYER USS PINCKNEY (DDG 91) AND SEVEN VISIT, BOARD, SEARCH, AND SEIZURE (VBSS) TEAM MEMBERS BOARDED A CARGO SHIP TO PROVIDE MEDICAL ASSISTANCE TO AN INJURED CIVILIAN, JAN. 1.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: PINCKNEYMEDICALTEAMTREATSINJUREDCIVILIANONMERCHANTVESSEL
    3. Title: USS PINCKNEY (DDG91)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: PINCKNEYSAILOR 2010OLYMPICTRIALS
    3. Title: PINCKNEY SAILOR COMPETES IN OLYMPIC BOXING QUALIFYER
    4. Description: SAN DIEGO (NNS) -- A SAN DIEGO-BASED SAILOR ASSIGNED TO USS PINCKNEY (DDG 91) WILL COMPETE IN THE 36TH ANNUAL NATIONAL ASSOCIATION OF POLICE ATHLETIC/ACTIVITIES LEAGUES (PAL) BOXING TOURNAMENT OCT. 2-9 IN SAN ANTONIO, WHICH COULD MEAN A SHOT AT THE 2012 OLYMPICS
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: PINCKNEYSAILOR 2010OLYMPICTRIALS
    3. Title: PINCKNEY SAILOR COMPETES IN OLYMPIC BOXING QUALIFYER
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: RTNS 8MO DEPLOYMENT
    3. Title: PINCKNEY WITH NIMITZ CARRIER STRIKE GROUP HOME AFTER EIGHT-MONTH DEPLOYMENT
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: RTNS 8MO DEPLOYMENT
    3. Title: PINCKNEY WITH NIMITZ CARRIER STRIKE GROUP HOME AFTER EIGHT-MONTH DEPLOYMENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: TOKUSHIMAFORPORTCALLVISIT
    3. Title: PINCKNEY ARRIVES IN TOKUSHIMA FOR PORT CALL VISIT
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: TOKUSHIMAFORPORTCALLVISIT
    3. Title: PINCKNEY ARRIVES IN TOKUSHIMA FOR PORT CALL VISIT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USINCREASESINTEROPERABILITYWITHJAPANINFIRSTGUAMEX
    3. Title: U.S. INCREASES INTEROPERABILITY WITH JAPAN IN FIRST GUAMEX
    4. Description: WATERS NEAR GUAM - THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS PINCKNEY (DDG 91) COMPLETED THE FIRST GUAM EXERCISE (GUAMEX) ALONGSIDE THE JAPAN MARITIME DEFENSE FORCE (JMSDF).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USINCREASESINTEROPERABILITYWITHJAPANINFIRSTGUAMEX
    3. Title: U.S. INCREASES INTEROPERABILITY WITH JAPAN IN FIRST GUAMEX
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USINDONESIANNAVIESCONDUCTCARATPASSINGEXERCISE
    3. Title: U.S., INDONESIAN NAVIES CONDUCT CARAT PASSING EXERCISE
    4. Description: SOUTH CHINA SEA – THE GUIDED MISSILE DESTROYER USS PINCKNEY (DDG 91) AND THE INDONESIAN NAVY FRIGATE KRI SLAMET RIYADI (F 352) CONDUCTED A TWO-DAY PASSING EXERCISE (PASSEX).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USINDONESIANNAVIESCONDUCTCARATPASSINGEXERCISE
    3. Title: U.S., INDONESIAN NAVIES CONDUCT CARAT PASSING EXERCISE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USNAVYCONTINUESMALAYSIAAIRLINESSEARCHEFFORT
    3. Title: U.S. NAVY CONTINUES MALAYSIA AIRLINES SEARCH EFFORT
    4. Description: PEARL HARBOR, HAWAII - A U.S. NAVY MH-60R HELICOPTER FROM USS PINCKNEY (DDG 91) WAS EXPECTED TO HAVE ABOUT 10 AND A HALF HOURS OF SEARCH COVERAGE IN THE GULF OF THAILAND (LOCAL TIME) AS A P-3C ORION AIRCRAFT SEARCHES AN AREA WEST OF MALAYSIA IN THE STRAIT OF MALACCA DURING CONTINUING SUPPORT OF THE SEARCH FOR MALAYSIA AIRLINES FLIGHT MH370.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USNAVYCONTINUESMALAYSIAAIRLINESSEARCHEFFORT
    3. Title: U.S. NAVY CONTINUES MALAYSIA AIRLINES SEARCH EFFORT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USP3ANDUSSPINCKNEYHELICOPTEROVERMALAYSIANAIRLINESSEARCHSITE
    3. Title: US P-3 AND USS PINCKNEY HELICOPTER OVER MALAYSIAN AIRLINES SEARCH SITE
    4. Description: GULF OF THAILAND - A NAVY P-3C ORION AND AN MH-60R HELICOPTER LAUNCHED FROM USS PINCKNEY (DDG 91) ARE SEARCHING OVER THE LAST KNOWN COMMUNICATION AND RADAR POSITIONS OF MALAYSIA AIRLINES MH370.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USP3ANDUSSPINCKNEYHELICOPTEROVERMALAYSIANAIRLINESSEARCHSITE
    3. Title: US P-3 AND USS PINCKNEY HELICOPTER OVER MALAYSIAN AIRLINES SEARCH SITE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USS INDEPENDENCE USS PINCKNEY ARRIVE IN ASTORIA TO KICK OFF PORTLAND FLEET WEEK
    3. Title: USS INDEPENDENCE USS PINCKNEY ARRIVE IN ASTORIA TO KICK-OFF PORTLAND FLEET WEEK
    4. Description: ASTORIA, ORE. – THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS PINCKNEY (DDG 91) AND LITTORAL COMBAT SHIP USS INDEPENDENCE (LCS 2) ARRIVED AT THE PORT OF ASTORIA, ORE. TO KICK-OFF THE 111TH ANNUAL PORTLAND ROSE FESTIVAL FLEET WEEK JUNE 5 THROUGH JUNE 9.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USS INDEPENDENCE USS PINCKNEY ARRIVE IN ASTORIA TO KICK OFF PORTLAND FLEET WEEK
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USS PINCKNEY HOSTS FAMILY DAY CRUISE
    3. Title: USS PINCKNEY HOSTS FAMILY DAY CRUISE
    4. Description: USS PINCKNEY (DDG 91) WELCOMED ABOARD 97 FAMILY MEMBERS AND FRIENDS FOR A FAMILY DAY CRUISE MARCH 4.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USS PINCKNEY HOSTS FAMILY DAY CRUISE
    3. Title: DDG91
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USS PINCKNEY ARRIVES IN HAWAII
    3. Title: USS PINCKNEY ARRIVES IN HAWAII
    4. Description: SAILORS ABOARD THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS PINCKNEY RENDER HONORS TO THE TICONDEROGA-CLASS GUIDED-MISSILE CRUISER USS LAKE ERIE (CG 70) AS PINCKNEY PULLS INTO JOINT BASE PEARL HARBOR-HICKAM FOR A PORT VISIT. PINCKNEY IS PART OF THE NIMITZ CARRIER STRIKE GROUP ON A REGULARLY SCHEDULED DEPLOYMENT TO THE WESTERN PACIFIC. THE U.S. NAVY HAS PATROLLED THE INDO-ASIA-PACIFIC FOR MORE THAN 70 YEARS PROMOTING PEACE AND SECURITY.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USS PINCKNEY ARRIVES IN HAWAII
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USS PINCKNEY TESTS MASS CASUALTY RESPONSE TEAM
    3. Title: USS PINCKNEY TESTS MASS CASUALTY RESPONSE TEAM
    4. Description: 5TH FLEET AREA OF OPERATIONS (NNS) -- THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS PINCKNEY (DDG 91) TESTED THE READINESS OF ITS MASS CASUALTY RESPONSE TEAM DURING A SIMULATED REAL-WORLD SCENARIO JULY 21.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USS PINCKNEY TESTS MASS CASUALTY RESPONSE TEAM
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USS PINCKNEY TO PARTICIPATE IN ASEAN MULTILATERAL NAVAL EXERCISE
    3. Title: USS PINCKNEY TO PARTICIPATE IN ASEAN MULTILATERAL NAVAL EXERCISE
    4. Description: THE ARLEIGH-BURKE CLASS GUIDED-MISSILE DESTROYER USS PINCKNEY (DDG 91) IS SCHEDULED TO PARTICIPATE IN THE ASSOCIATION OF SOUTHEAST ASIAN NATIONS (ASEAN) MULTILATERAL NAVAL EXERCISE IN PATTAYA BAY, THAILAND, NOV. 18-20.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USS PINCKNEY TO PARTICIPATE IN ASEAN MULTILATERAL NAVAL EXERCISE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USS PINCKNEY VISITS HAWAII AS DEPLOYMENT NEARS END
    3. Title: USS PINCKNEY VISITS HAWAII AS DEPLOYMENT NEARS END
    4. Description: THE GUIDED-MISSILE DESTROYER USS PINCKNEY (DDG 91) ARRIVED AT JOINT BASE PEARL HARBOR-HICKAM, DEC. 4 FOLLOWING A SIX-MONTH DEPLOYMENT TO THE INDO-ASIA-PACIFIC REGION AND THE ARABIAN GULF.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USS PINCKNEY VISITS HAWAII AS DEPLOYMENT NEARS END
    3. Title: USS PINCKNEY
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USSPINCKNEY(DDG91)PARTICIPATESINSANFRANCISCOFLEETWEEK2010
    3. Title: USS PINCKNEY ENGAGED IN SAN FRANCISCO FLEET WEEK 2010
    4. Description: SAN FRANCISCO (OCT. 9, 2010) - THE GUIDED-MISSILE DESTROYER USS PINCKNEY (DDG 91) PASSES UNDER THE GOLDEN GATE BRIDGE DURING THE PARADE OF SHIPS AT SAN FRANCISCO FLEET WEEK 2010. SAN FRANCISCO FLEET WEEK IS A FIVE-DAY EVENT, WHICH HIGHLIGHTS THE EQUIPMENT, TECHNOLOGY AND OPERATIONAL CAPABILITIES OF THE MILITARY'S SEA SERVICES AND THEIR HISTORY WITH THE SAN FRANCISCO AREA.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USSPINCKNEY(DDG91)PARTICIPATESINSANFRANCISCOFLEETWEEK2010
    3. Title: USS PINCKNEY PARTICIPATES IN SAN FRANCISCO FLEET WEEK 2010
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USSPINCKNEY(DDG91)PORTVISITTOINCHEONKOREA
    3. Title: USS PINCKNEY (DDG 91) PORT VISIT TO INCHEON KOREA
    4. Description: THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS PINCKNEY (DDG 91) PULLS INTO A LOCK GATE TO ACCOMMODATE FOR DIFFERENT WATER LEVELS AS THE SHIP MAKES WAY TO PORT IN INCHEON, REPUBLIC OF KOREA. PINCKNEY IS IN THE U.S. 7TH FLEET AREA OF RESPONSIBILITY.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USSPINCKNEY(DDG91)PORTVISITTOINCHEONKOREA
    3. Title: USS PINCKNEY (DDG 91) PULLS INTO A LOCK GATE TO ACCOMMODATE FOR DIFFERENT WATER LEVELS ON THE WAY TO PORT IN INCHEON ROK
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USSPINCKNEY(DDG91)INSOUTHCHINASEA
    3. Title: USS PINCKNEY (DDG 91) DURING RAS IN SOUTH CHINA SEA
    4. Description: SOUTH CHINA SEA - GUNNER'S MATE 3RD CLASS MAXWELL LINK TAKES THE SLACK FROM A LINE PULLING A FUELING PROBE DURING A REPLENISHMENT AT SEA ABOARD THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS PINCKNEY (DDG 91). PINCKNEY IS DEPLOYED IN THE U.S. 7TH FLEET AREA OF RESPONSIBILITY.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USSPINCKNEY(DDG91)INSOUTHCHINASEA
    3. Title: USS PINCKNEY (DDG 91) GUNNERS MATE 3RD CLASS MAXWELL LINK DURING RAS IN SOUTH CHINA SEA
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USSPINCKNEYAWARDEDUSSARIZONAMEMORIALTROPHY
    3. Title: USS PINCKNEY (DDG 91) IS MOORED AND NAVAL STATION SAN DIEGO
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USSPINCKNEYAWARDEDUSSARIZONAMEMORIALTROPHY
    3. Title: USS PINCKNEY AWARDED USS ARIZONA MEMORIAL TROPHY
    4. Description: SAILORS ABOARD THE ARLEIGH BURKE-CLASS GUIDED MISSILE DESTROYER (DDG) USS PINCKNEY (DDG 91) EARNED THE USS ARIZONA MEMORIAL TROPHY.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USSPINCKNEYDISRUPTSPIRACY
    3. Title: USS PINCKNEY (DDG91)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USSPINCKNEYDISRUPTSPIRACY
    3. Title: USS PINCKNEY DISRUPTS PIRACY
    4. Description: USS PINCKNEY, GULF OF ADEN - GUIDED-MISSILE DESTROYER USS PINCKNEY (DDG 91), ASSIGNED TO COMBINED TASK FORCE (CTF) 151, DISRUPTED A GROUP OF SUSPECTED PIRATES CLOSE TO THE INTERNATIONALLY RECOMMENDED TRANSIT CORRIDOR (IRTC), SOUTH OF YEMEN, DEC. 19.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USSPINCKNEYP3CAIRCRAFTTOASSISTINMALAYSIANAIRSEARCH
    3. Title: USS PINCKNEY, P-3C AIRCRAFT TO ASSIST IN MALAYSIAN AIR SEARCH
    4. Description: PACIFIC OCEAN - USS PINCKNEY (DDG 91), AN ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER, IS EN ROUTE TO THE SOUTHERN COAST OF VIETNAM TO AID IN THE SEARCH EFFORTS OF THE MISSING MALAYSIA AIRLINES FLIGHT MH370.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USSPINCKNEYP3CAIRCRAFTTOASSISTINMALAYSIANAIRSEARCH
    3. Title: USS PINCKNEY, P-3C AIRCRAFT TO ASSIST IN MALAYSIAN AIR SEARCH
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USSPINCKNEYVISITSPYEONGTAEKSOUTHKOREA
    3. Title: USS PINCKNEY VISITS PYEONGTAEK, SOUTH KOREA
    4. Description: PYONGTAEK, REPUBLIC OF KOREA - THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS PINCKNEY (DDG 91) ARRIVED IN PYEONGTAEK, SOUTH KOREA AS PART OF A REGULARLY SCHEDULED PORT VISIT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USSPINCKNEYVISITSPYEONGTAEKSOUTHKOREA
    3. Title: USS PINCKNEY VISITS PYEONGTAEK, SOUTH KOREA
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USSPINCKNEYANDUSSKIDDRETURNFROMDEPLOYMENT
    3. Title: USS PINCKNEY AND USS KIDD RETURN FROM DEPLOYMENT
    4. Description: SAN DIEGO - THE GUIDED MISSILE DESTROYERS USS PINCKNEY (DDG 91) AND USS KIDD (DDG 100) RETURNED TO NAVAL BASE SAN DIEGO FOLLOWING COMPLETION OF SEPARATE DEPLOYMENTS TO THE WESTERN PACIFIC AND INDIAN OCEANS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: USSPINCKNEYANDUSSKIDDRETURNFROMDEPLOYMENT
    3. Title: USS PINCKNEY AND USS KIDD RETURN FROM DEPLOYMENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO1 26JANUARY2018 3JULY2019
    3. Title: CDR BENJAMIN W. OAKES
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO1 26JANUARY2018 3JULY2019
    3. Title: COMMANDING OFFICER (JANUARY 26, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO1 6FEBRUARY2015 26AUGUST2016
    3. Title: CDR RYAN J. BLAZEVICH
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO1 6FEBRUARY2015 26AUGUST2016
    3. Title: COMMANDER RYAN J. BLAZEVICH
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO1 6SEPT2013 5FEB2015
    3. Title: CDR FRANK E. OKATA
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO1 6SEPT2013 5FEB2015
    3. Title: COMMANDER FRANK E. OKATA
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO1 APRIL2012 RELIEVED
    3. Title: COMMANDER MATTHEW MCGONIGLE
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO1 APRIL2012 RELIEVED
    3. Title: COMMANDING OFFICER (APR 2010 - APR 2012)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO1
    3. Title: (JULY 4, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO1
    3. Title: CDR ANDREW ROY
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO2 14NOVEMBER2017 16APRIL2019
    3. Title: CDR ANDREW ROY
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO2 14NOVEMBER2017 16APRIL2019
    3. Title: NOVEMBER 14, 2017 - PRESENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO2 15JUNE2016 13NOV2017
    3. Title: (JUNE 15, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO2 15JUNE2016 13NOV2017
    3. Title: CDR BENJAMIN W. OAKES
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO2 16SEPT2013 29DEC2014
    3. Title: CDR RYAN J. BLAZEVICH
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO2 16SEPT2013 29DEC2014
    3. Title: COMMANDER RYAN J. BLAZEVICH
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO2 30DECEMBER2014 23JUNE2016
    3. Title: CDR FRANK WALTER
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO2 30DECEMBER2014 23JUNE2016
    3. Title: EXECUTIVE OFFICER
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO2 APRIL2012 RELIEVED
    3. Title: COMMANDER BENJAMIN R. NICHOLSON
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO2 APRIL2012 RELIEVED
    3. Title: EXECUTIVE OFFICER (SEPT 15, 2011 - APR 13, 2012)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO2
    3. Title: (APRIL 17, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO2
    3. Title: CDR R. P. CONOLE
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO3 FEB2013 JULY2015
    3. Title: CMDCM RALPH S. CROWDER III
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO3 FEB2013 JULY2015
    3. Title: COMMAND MASTER CHIEF (FEBRUARY 26, 2013 - JULY 13, 2015)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO3
    3. Title: CMDCM(SW/AW) MELVIN L. ISOM
    4. Description: COMMAND MASTER CHIEF
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BIO3
    3. Title: COMMAND MASTER CHIEF (JANUARY 11, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BOXER ADVANCES
    3. Title: 100420-N-0227C-002 PORT HUENEME, CALIF. - ARMED FORCES BOXING CHAMPIONSHIP AT NAVAL BASE VENTURA COUNTY, PORT HUENEME. DIAZ WON
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: BOXER ADVANCES
    3. Title: PINCKNEY BOXER ADVANCES TO THE ARMED FORCES BOXING CHAMPIONSHIP FINALS
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: DEFAULT
    3. Title: USS PINCKNEY (DDG 91)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: DEFAULT
    3. Title: USS PINCKNEY (DDG 91)
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: FAMILY
    3. Title: FAMILY - USS PINCKNEY
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: NAMESAKE
    3. Title: NAMED FOR NAVY COOK FIRST CLASS WILLIAM PINCKNEY
    4. Description: AT THE BATTLE OF SANTA CRUZ ON OCTOBER 26TH, 1942, THE CARRIER USS HORNET (CV 8) WAS SUNK AND THE ENTERPRISE WOULD BE HIT TWICE BY JAPANESE BOMBS, KILLING 44 SAILORS AND LEAVING 75 WOUNDED. IT WAS HERE THAT WILLIAM PINCKNEY WOULD EARN THE NAVY CROSS AND PURPLE HEART FOR HIS ACTIONS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: OURSHIP
    3. Title: ABOUT US
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: PHOTOS
    3. Title: USS PINCKNEY PHOTO GALLERY
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: PINCKNEYSUPPORTSFISHERIES
    3. Title: PINCKNEY SUPPORTS USCG FISHERIES ENFORCEMENT IN PACIFIC
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: PINCKNEYSUPPORTSFISHERIES
    3. Title: PINCKNEY SUPPORTS USCG FISHERIES ENFORCEMENT IN PACIFIC
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: PINCKNEYVISITSREDCROSS
    3. Title: PINCKNEY SAILORS VISIT TOKUSHIMA RED CROSS HOSPITAL
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PAGES
    2. File: PINCKNEYVISITSREDCROSS
    3. Title: PINCKNEY SAILORS VISIT TOKUSHIMA RED CROSS HOSPITAL
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: CDR ROY NEW SMALL
    3. Title: (JULY 4, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: CDR ROY NEW
    3. Title: (JULY 4, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: CDR WALTER SMALL
    3. Title: AUGSUT 27, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: CDR WALTER
    3. Title: AUGSUT 27, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: CMC CROWDER SMALL
    3. Title: COMMAND MASTER CHIEF (FEBRUARY 26, 2013 - JULY 13, 2015)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: CMC CROWDER
    3. Title: COMMAND MASTER CHIEF (FEBRUARY 26, 2013 - JULY 13, 2015)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: CMC ISOM
    3. Title: COMMAND MASTER CHIEF (JANUARY 11, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: CMC
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: CO BLAZEVICH SMALL
    3. Title: CDR RYAN J. BLAZEVICH
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: CO CDR OAKES SM
    3. Title: COMMANDING OFFICER (JANUARY 26, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: CO CDR OAKES
    3. Title: COMMANDING OFFICER (JANUARY 26, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: CO CDROKATA
    3. Title: CDR FRANK E. OKATA
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: CO DDG91 THUMBNAIL
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: CO
    3. Title: COMMANDING OFFICER (APR 2010 - APR 2012)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: DDG91 NOV09
    3. Title: USS PINCKNEY PACFIRE TRAINING EXERCISE
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: XO BLAZEVICH SMALL
    3. Title: CDR RYAN J. BLAZEVICH
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: XO BLAZEVICH
    3. Title: CDR RYAN J. BLAZEVICH
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: XO NICHOLSON
    3. Title: EXECUTIVE OFFICER (SEPT 15, 2011 - APR 13, 2012)
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: XO WALTER SMALL
    3. Title: EXECUTIVE OFFICER
    4. No description
    5. No keywords
    6. Extension: JPEG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: XO WALTER
    3. Title: EXECUTIVE OFFICER
    4. No description
    5. No keywords
    6. Extension: JPEG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: XO DDG91
    3. Title: EXECUTIVE OFFICER (4/15/2012 - 9/5/2013)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: BAGWELL PORTRAIT
    3. Title: BAGWELL
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: CDR CONOLE SMALL
    3. Title: (APRIL 17, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: CDR CONOLE
    3. Title: (APRIL 17, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: ENTERPRISE SANTACRUZ
    3. Title: USS ENTERPRISE AT SANTA CRUZ
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: HENRIETTA HULL
    3. Title: HENRIETTA PINCKNEY
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: PINCKNEY PORTRAIT
    3. Title: PINCKNEY
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: PINCKNEY XO
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: XO CDR OAKES SMALL
    3. Title: (JUNE 15, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: XO CDR OAKES
    3. Title: (JUNE 15, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: XO ROY SMALL
    3. Title: NOVEMBER 14, 2017 - PRESENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PUBLISHINGIMAGES
    2. File: XO ROY
    3. Title: NOVEMBER 14, 2017 - PRESENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: 7THFLEETADJUSTSEFFORTSINSUPPORTOFMH370SEARCH
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: 7THFLEETADJUSTSEFFORTSINSUPPORTOFMH370SEARCH
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: ANNUALPHYSICALHEALTHASSESSMENT(PHA)
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: ANNUALPHYSICALHEALTHASSESSMENT(PHA)
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO1 27AUG2016 25JAN2018
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO1 27AUG2016 25JAN2018
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO1 APR2012 SEP2013
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO1 APR2012 SEP2013
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO1
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO1
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO2 APR2012 SEP2013
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO2 APR2012 SEP2013
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO2 RELIEVEDSEP2011
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO2 RELIEVEDSEP2011
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO3 DEC2010 25FEB2013
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO3 DEC2010 25FEB2013
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BOATSWAINSMATESEAMANVICTORHERNANDEZABOARD
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BOATSWAINSMATESEAMANVICTORHERNANDEZABOARD
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: COMLOGWESTPACHOLDSALLHANDSCALLABOARDPINCKNEY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: COMLOGWESTPACHOLDSALLHANDSCALLABOARDPINCKNEY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: CALIFORNIA BASEDSAILORSCLEANUPBEACHFOREARTHDAY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: CALIFORNIA BASEDSAILORSCLEANUPBEACHFOREARTHDAY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: DDG93 MK45
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: DDG93 MK45
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: FAMILY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: FAMILY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: MIDSHIPMENJOINPINCKNEYCREWFORUNDERWAYREPLENISHMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: MIDSHIPMENJOINPINCKNEYCREWFORUNDERWAYREPLENISHMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: NEWS ARCHIVE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: NEWS ARCHIVE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: PARADEOFSHIPSMAKESGRANDENTRANCEDURINGSANFRANCISCOFLEETWEEK
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: PARADEOFSHIPSMAKESGRANDENTRANCEDURINGSANFRANCISCOFLEETWEEK
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: PASTLEADERSHIP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: PASTLEADERSHIP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: PINCKNEYMEDICALTEAMTREATSINJUREDCIVILIANONMERCHANTVESSEL
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: PINCKNEYMEDICALTEAMTREATSINJUREDCIVILIANONMERCHANTVESSEL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: PINCKNEYSAILOR 2010OLYMPICTRIALS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: PINCKNEYSAILOR 2010OLYMPICTRIALS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: RTNS 8MO DEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: RTNS 8MO DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: TOKUSHIMAFORPORTCALLVISIT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: TOKUSHIMAFORPORTCALLVISIT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USINCREASESINTEROPERABILITYWITHJAPANINFIRSTGUAMEX
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USINCREASESINTEROPERABILITYWITHJAPANINFIRSTGUAMEX
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USINDONESIANNAVIESCONDUCTCARATPASSINGEXERCISE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USINDONESIANNAVIESCONDUCTCARATPASSINGEXERCISE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USNAVYCONTINUESMALAYSIAAIRLINESSEARCHEFFORT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USNAVYCONTINUESMALAYSIAAIRLINESSEARCHEFFORT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USP3ANDUSSPINCKNEYHELICOPTEROVERMALAYSIANAIRLINESSEARCHSITE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USP3ANDUSSPINCKNEYHELICOPTEROVERMALAYSIANAIRLINESSEARCHSITE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USS INDEPENDENCE USS PINCKNEY ARRIVE IN ASTORIA TO KICK OFF PORTLAND FLEET WEEK
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USS INDEPENDENCE USS PINCKNEY ARRIVE IN ASTORIA TO KICK OFF PORTLAND FLEET WEEK
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USS PINCKNEY HOSTS FAMILY DAY CRUISE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USS PINCKNEY HOSTS FAMILY DAY CRUISE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USS PINCKNEY ARRIVES IN HAWAII
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USS PINCKNEY ARRIVES IN HAWAII
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USS PINCKNEY TESTS MASS CASUALTY RESPONSE TEAM
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USS PINCKNEY TESTS MASS CASUALTY RESPONSE TEAM
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USS PINCKNEY TO PARTICIPATE IN ASEAN MULTILATERAL NAVAL EXERCISE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USS PINCKNEY TO PARTICIPATE IN ASEAN MULTILATERAL NAVAL EXERCISE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USS PINCKNEY VISITS HAWAII AS DEPLOYMENT NEARS END
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USS PINCKNEY VISITS HAWAII AS DEPLOYMENT NEARS END
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USSPINCKNEY(DDG91)PARTICIPATESINSANFRANCISCOFLEETWEEK2010
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USSPINCKNEY(DDG91)PARTICIPATESINSANFRANCISCOFLEETWEEK2010
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USSPINCKNEY(DDG91)PORTVISITTOINCHEONKOREA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USSPINCKNEY(DDG91)PORTVISITTOINCHEONKOREA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USSPINCKNEY(DDG91)INSOUTHCHINASEA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USSPINCKNEY(DDG91)INSOUTHCHINASEA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USSPINCKNEYAWARDEDUSSARIZONAMEMORIALTROPHY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USSPINCKNEYAWARDEDUSSARIZONAMEMORIALTROPHY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USSPINCKNEYDISRUPTSPIRACY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USSPINCKNEYDISRUPTSPIRACY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USSPINCKNEYP3CAIRCRAFTTOASSISTINMALAYSIANAIRSEARCH
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USSPINCKNEYP3CAIRCRAFTTOASSISTINMALAYSIANAIRSEARCH
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USSPINCKNEYVISITSPYEONGTAEKSOUTHKOREA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USSPINCKNEYVISITSPYEONGTAEKSOUTHKOREA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USSPINCKNEYANDUSSKIDDRETURNFROMDEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: USSPINCKNEYANDUSSKIDDRETURNFROMDEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO1 26JANUARY2018 3JULY2019
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO1 26JANUARY2018 3JULY2019
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO1 6FEBRUARY2015 26AUGUST2016
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO1 6FEBRUARY2015 26AUGUST2016
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO1 6SEPT2013 5FEB2015
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO1 6SEPT2013 5FEB2015
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO1 APRIL2012 RELIEVED
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO1 APRIL2012 RELIEVED
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO1
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO1
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO2 14NOVEMBER2017 16APRIL2019
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO2 14NOVEMBER2017 16APRIL2019
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO2 15JUNE2016 13NOV2017
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO2 15JUNE2016 13NOV2017
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO2 16SEPT2013 29DEC2014
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO2 16SEPT2013 29DEC2014
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO2 30DECEMBER2014 23JUNE2016
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO2 30DECEMBER2014 23JUNE2016
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO2 APRIL2012 RELIEVED
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO2 APRIL2012 RELIEVED
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO2
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO2
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO3 FEB2013 JULY2015
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO3 FEB2013 JULY2015
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO3
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BIO3
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BOXER ADVANCES
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: BOXER ADVANCES
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: DEFAULT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: DEFAULT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: FAMILY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: FAMILY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: NAMESAKE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: NAMESAKE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: PHOTOS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: PHOTOS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: PINCKNEYSUPPORTSFISHERIES
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: PINCKNEYSUPPORTSFISHERIES
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: PINCKNEYVISITSREDCROSS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: LAYOUTS: AUTHENTICATE
    2. File: PINCKNEYVISITSREDCROSS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG91: PHOTOGALLERY
    2. File: 100420 N PINCKNEY BOXER DIAZ
    3. Title: 100420-N-0227C-002 PORT HUENEME, CALIF. - ARMED FORCES BOXING CHAMPIONSHIP AT NAVAL BASE VENTURA COUNTY, PORT HUENEME. DIAZ WON
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PHOTOGALLERY
    2. File: 100511 N 2259P 051
    3. Title: ANNUAL PHYSICAL HEALTH ASSESSMENT (PHA)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PHOTOGALLERY
    2. File: 111219 N ZZ999 076
    3. Title: USS PINCKNEY (DDG91)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PHOTOGALLERY
    2. File: 120101 N ED900 197
    3. Title: USS PINCKNEY (DDG91)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PHOTOGALLERY
    2. File: DDG 91 KOREA LOCK GATE WEB 111017 N ED900 088
    3. Title: USS PINCKNEY (DDG 91) PULLS INTO A LOCK GATE TO ACCOMMODATE FOR DIFFERENT WATER LEVELS ON THE WAY TO PORT IN INCHEON ROK
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PHOTOGALLERY
    2. File: DDG91 RAS WEB 111106 N ED900 273
    3. Title: USS PINCKNEY (DDG 91) GUNNERS MATE 3RD CLASS MAXWELL LINK DURING RAS IN SOUTH CHINA SEA
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PHOTOGALLERY
    2. File: WEB 101009 N 1805P 107
    3. Title: USS PINCKNEY PARTICIPATES IN SAN FRANCISCO FLEET WEEK 2010
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PHOTOGALLERY
    2. File: WEB 101009 N 3570S 046
    3. Title: USS PINCKNEY PARTICIPATES IN SAN FRANCISCO FLEET WEEK 2010
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91: PHOTOGALLERY
    2. File: WEB 110727 N RR095 001
    3. Title: USS PINCKNEY (DDG 91) IS MOORED AND NAVAL STATION SAN DIEGO
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG91
    2. No filename (redirect)
    3. Title: USS PINCKNEY
    4. No description
    5. No keywords
    6. No extension (redirect)


    1. Path: SURFOR: DDG92: PAGES
    2. File: AN ICY REMINDER IN AN ARCTIC THAW
    3. Title: AN ICY REMINDER IN AN ARCTIC THAW
    4. Description: USS MOMSEN (DDG 92) IS VISITING ANCHORAGE, ALASKA, THIS WEEK IN SUPPORT OF THE 2018 ARCTIC MARITIME SYMPOSIUM.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: AN ICY REMINDER IN AN ARCTIC THAW
    3. Title: DDG92
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: ANTITERRORISMEXERCISEONBOARDUSSMOMSEN
    3. Title: ANTIERERRORISM EXERCISE ONBOARD USS MOMSEN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: ANTITERRORISMEXERCISEONBOARDUSSMOMSEN
    3. Title: CITADEL PROTECT JOINS EVERETT, USS MOMSEN
    4. Description: EVERETT, WASH. - ELECTRONICS TECHNICIAN 3RD CLASS THOMAS CYR FIRES BLANK ROUNDS FROM AN M240 MACHINE GUN ABOARD USS MOMSEN (DDG 92) AT A SIMULATED ENEMY SMALL BOAT DURING THE ANTI-TERRORISM TRAINING EXERCISE CITADEL PROTECT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO1 14MAR2013 20AUG2014
    3. Title: CDR ELAINE A. COLLINS
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO1 14MAR2013 20AUG2014
    3. Title: CDR ELAINE A. COLLINS
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO2 07NOV2011 20FEB2013
    3. Title: CDR ELAINE A. COLLINS
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO2 07NOV2011 20FEB2013
    3. Title: CDR ELAINE A. COLLINS
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO2 22FEB2013 10AUG2014
    3. Title: CDR JAVIER GONZALEZ
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO2 22FEB2013 10AUG2014
    3. Title: CDR JAVIER GONZALEZ
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO2
    3. Title: CDR ERIK S. ROBERTS
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO3 16NOV2012 26OCT2014
    3. Title: CMDCM PAUL J. MCFADDEN
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO3 16NOV2012 26OCT2014
    3. Title: CMDCM PAUL J. MCFADDEN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO3 DEC2009 NOV2012
    3. Title: CMDCM MARK SWAB
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO3 DEC2009 NOV2012
    3. Title: CMDCM MARK SWAB
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: CHANGEOFCOMMANDCEREMONYONUSSMOMSEN
    3. Title: CHANGE OF COMMAND CEREMONY ON USS MOMSEN
    4. Description: EVERETT, WA - USS MOMSEN (DDG 92) CELEBRATED CMDR. ELAINE COLLINS’ ASSUMPTION OF COMMAND WITH HUMOR AND, FORTUNATELY, BRIGHT SUNLIGHT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: CHANGEOFCOMMANDCEREMONYONUSSMOMSEN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: CHGCMD
    3. Title: CMDR. JAY D. WYLIE, RIGHT, RELIEVES CMDR. ROBERT W. BODVAKE AS COMMANDING OFFICER OF USS MOMSEN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: CHGCMD
    3. Title: MOMSEN HOLDS CHANGE OF COMMAND CEREMONY
    4. Description: THE COMMAND OF THE EVERETT HOMEPORTED GUIDED MISSILE DESTROYER, USS MOMSEN (DDG 92), CHANGED HANDS IN A CEREMONY ON BOARD THE VESSEL, JULY 8, AS CMDR. JAY D. WYLIE RELIEVED CMDR. ROBERT W. BODVAKE SHIP’S COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: CMBTMSNTRNG
    3. Title: MOMSEN REACHES TARGET DURING COMBAT MISSION TRAINING
    4. Description: USS MOMSEN, AT SEA (NNS) -- USS MOMSEN (DDG 92) FIRED 60 SHELLS DOWNRANGE UNDER THE PRESSURE OF A SIMULATED COMBAT SCENARIO JULY 28 AS PART OF A COMPOSITE UNIT TRAINING EXERCISE (COMPTUEX)
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: CMBTMSNTRNG
    3. Title: MOMSEN REACHES TARGET DURING COMBAT MISSION TRAINING
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: DRYDOCKPERIODCONTINUESFORUSSMOMSEN
    3. Title: DRY DOCK PERIOD CONTINUES FOR USS MOMSEN
    4. Description: SEATTLE - THE GUIDED-MISSILE DESTROYER USS MOMSEN (DDG 92) IS IN VIGOR SHIPYARDS, SEATTLE, WA., DURING A SCHEDULED SIX-MONTH DRY DOCK AVAILABILITY TO CONDUCT CRITICAL REPAIRS AND MAINTENANCE.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: DRYDOCKPERIODCONTINUESFORUSSMOMSEN
    3. Title: USS MOMSEN (DDG 92) IN DRY DOCK PERIOD
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: EVERETTSAILORSRECEIVEHALSLEWISLEADERSHIPEXCELLENCEAWARD
    3. Title: EVERETT SAILORS RECEIVE HAL S. LEWIS LEADERSHIP EXCELLENCE AWARD
    4. Description: EVERETT, WASH. - TWO SAILORS STATIONED IN THE PACIFIC NORTHWEST RECEIVED THE HAL S. LEWIS LEADERSHIP EXCELLENCE AWARD AT THE WILLIAM E. MOORE AUDITORIUM ON NAVAL STATION EVERETT (NSE).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: EVERETTSAILORSRECEIVEHALSLEWISLEADERSHIPEXCELLENCEAWARD
    3. Title: EVERETT SAILORS RECEIVE HAL S. LEWIS LEADERSHIP EXCELLENCE AWARD
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: FAMILYPAGE
    3. Title: FAMILY PAGE
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: HOLYHELOARRIVESABOARDUSSMOMSEN
    3. Title: 'HOLY HELO'ARRIVES ABOARD USS MOMSEN
    4. Description: USS MOMSEN, AT SEA - A NAVY CHAPLAIN ASSIGNED TO THE NIMITZ-CLASS AIRCRAFT CARRIER USS GEORGE WASHINGTON (CVN 73) VISITED THE GUIDED-MISSILE DESTROYER USS MOMSEN (DDG 92) VIA HELICOPTER.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: HOLYHELOARRIVESABOARDUSSMOMSEN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: MANOVERBOARDDRILLONUSSMOMSEN
    3. Title: MAN OVERBOARD DRILL ON USS MOMSEN
    4. Description: GULF OF ADEN (MARCH 9, 2012) -BOATSWAIN'S MATE 2ND CLASS STEVEN WAGNER, A SEARCH AND RESCUE SWIMMER ASSIGNED TO THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MOMSEN (DDG 92), RETRIEVES A SAILOR FROM THE WATER DURING A MAN OVERBOARD DRILL.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: MANOVERBOARDDRILLONUSSMOMSEN
    3. Title: USS MOMSEN (DDG92)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: MOMSEN ARRIVES IN SAIPAN
    3. Title: DDG92
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: MOMSEN ARRIVES IN SAIPAN
    3. Title: MOMSEN ARRIVES IN SAIPAN
    4. Description: SAIPAN (NNS) -- GUIDED-MISSILE DESTROYER USS MOMSEN (DDG 92) ARRIVED IN SAIPAN FOR A REGULARLY SCHEDULED PORT CALL, SEPT. 24.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: MOMSEN COMPLETES INSURV IN PACIFIC NW
    3. Title: MOMSEN COMPLETES INSURV IN PACIFIC NW
    4. Description: THIS PAST FALL, THE GUIDED MISSILE DESTROYER USS MOMSEN (DDG 92) BEGAN PREPARING FOR ITS TYCOM MATERIAL INSPECTION (TMI) AND CONGRESSIONALLY MANDATED BOARD OF INSPECTION AND SURVEY (INSURV), HER FIRST SINCE MARCH 2009.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: MOMSEN COMPLETES INSURV IN PACIFIC NW
    3. Title: USS MOMSEN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: MOMSENCONDUCTSBOARDINGEXERCISE
    3. Title: MOMSEN CONDUCTS BOARDING EXERCISE
    4. Description: USS MOMSEN, AT SEA - USS MOMSEN (DDG 92) CONDUCTED HELICOPTER VISIT BOARD SEARCH AND SEIZURE (HVBSS) TRAINING JAN. 17 TO PREPARE FOR OPERATIONS IN THE U.S. 5TH FLEET AREA OF RESPONSIBILITY (AOR).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: MOMSENCONDUCTSBOARDINGEXERCISE
    3. Title: MOMSEN CONDUCTS BOARDING EXERCISE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: MOMSENEXPEDITIONARYMEDICALTEAMPREPAREDTOSUPPORTVBSSTEAM
    3. Title: MOMSEN EXPEDITIONARY MEDICAL TEAM PREPARED TO SUPPORT VBSS TEAM
    4. Description: USS MOMSEN, AT SEA - A TEAM OF MEDICAL OFFICERS AND HOSPITAL CORPSMEN ASSIGNED TO THE 8TH EXPEDITIONARY RESUSCITATIVE SURGICAL SYSTEM (ERSS), EMBARKED ABOARD GUIDED-MISSILE DESTROYER USS MOMSEN (DDG 92), ARE PREPARED, SHOULD THE NEED TO ARISE, TO RENDER MEDICAL ASSISTANCE TO MEMBERS OF VISIT, BOARD, SEARCH AND SEIZURE (VBSS) TEAM.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: MOMSENEXPEDITIONARYMEDICALTEAMPREPAREDTOSUPPORTVBSSTEAM
    3. Title: USS MOMSEN (DDG92)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: MOMSENSAILORSMARCHINSAIPANSLIBERATIONDAYPARADE
    3. Title: MOMSEN SAILORS MARCH IN SAIPAN'S LIBERATION DAY PARADE
    4. Description: SAIPAN - SAILORS AND EMBARKED MIDSHIPMEN OF THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MOMSEN (DDG 92) PARTICIPATED IN A LOCAL PARADE, JULY 4, TO COMMEMORATE LIBERATION DAY IN SAIPAN.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: MOMSENSAILORSMARCHINSAIPANSLIBERATIONDAYPARADE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: NEWS ARCHIVE
    3. Title: NEWS ARCHIVE
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: OMBUDSMAN
    3. Title: OMBUDSMAN
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: PASTLEADERSHIP
    3. Title: PAST LEADERSHIP
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: PHOTOS
    3. Title: PHOTOS
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: REPLENISHMENTATSEAONUSSMOMSEN(DDG92)
    3. Title: REPLENISHMENT AT SEA ON USS MOMSEN (DDG 92)
    4. Description: ARABIAN SEA - USS MOMSEN IS ALONGSIDE THE MILITARY SEALIFT COMMAND DRY CARGO AND AMMUNITION SHIP USNS CHARLES R. DREW (T-AKE 10) DURING A REFUELING AT SEA. (U.S. NAVY PHOTO BY MASS COMMUNICATION SPECIALIST 3RD CLASS KENNETH ABBATE/RELEASED
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: REPLENISHMENTATSEAONUSSMOMSEN(DDG92)
    3. Title: USS MOMSEN (DDG 92)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: SAILORSABOARDUSSMOMSENRESPONDTOAMEDICALEMERGENCY
    3. Title: SAILORS ABOARD USS MOMSEN (DDG 92) RESPOND TO A MEDICAL EMERGENCY
    4. Description: ARABIAN SEA (JAN. 5, 2011) SAILORS ASSIGNED TO THE GUIDED-MISSILE DESTROYER USS MOMSEN (DDG 92) RESPOND TO A MEDICAL EMERGENCY ABOARD AN IRANIAN FISHING VESSEL APPROXIMATELY 400 NAUTICAL MILES NORTH OF SEYCHELLES, OFF THE COAST OF SOMALIA JAN. 5.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: SAILORSABOARDUSSMOMSENRESPONDTOAMEDICALEMERGENCY
    3. Title: SAILORS ASSIGNED TO THE GUIDED-MISSILE DESTROYER USS MOMSEN (DDG 92) RESPOND TO A MEDICAL EMERGENCY
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: STRIKEGRPOPNS
    3. Title: SHOUP, MOMSEN TRAIN FOR STRIKE GROUP OPERATIONS
    4. Description: USS SHOUP, AT SEA (NNS) -- USS SHOUP (DDG 86) AND USS MOMSEN (DDG 92) DEPARTED NAVAL STATION EVERETT, WASH., JULY 15 TO PARTICIPATE IN A COMPOSITE TRAINING UNIT EXERCISE (COMPTUEX) WITH THE ABRAHAM LINCOLN STRIKE GROUP.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: STRIKEGRPOPNS
    3. Title: SHOUP, MOMSEN TRAIN FOR STRIKE GROUP OPERATIONS
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USNAVYSHIPSDISRUPTPIRATEATTACK
    3. Title: TWO SMALL BOATS USED BY SUSPECTED PIRATES IN THE ARABIAN SEA ARE DESTROYED BY USS MOMSEN (DDG 92)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USNAVYSHIPSDISRUPTPIRATEATTACK
    3. Title: US NAVY SHIPS DISRUPT PIRATE ATTACK
    4. Description: ARABIAN SEA (FEB. 2) TWO SMALL BOATS USED BY SUSPECTED PIRATES IN THE ARABIAN SEA ARE DESTROYED BY USS MOMSEN (DDG 92), AFTER THE GUIDED-MISSILE DESTROYER RECEIVED A DISTRESS CALL AND DISRUPTED AN ATTACK ON A COMMERCIAL OIL TANKER.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USS MOMSEN HOLDS CHANGE OF COMMAND CEREMONY 2018
    3. Title: USS MOMSEN HOLDS CHANGE OF COMMAND CEREMONY
    4. Description: SAN DIEGO, CA – ON DECEMBER 04 2018, THE CREW OF USS MOMSEN (DDG 92) STOOD IN FORMATION ON THE FLIGHT DECK TO HOLD THE CHANGE OF COMMAND CEREMONY WHILE PIER SIDE AT NAVAL BASE SAN DIEGO.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USS MOMSEN HOLDS CHANGE OF COMMAND CEREMONY 2018
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USS MOMSEM UNDERWAY AGAIN FOR FIRST TIME IN 18 MONTHS
    3. Title: USS MOMSEM UNDERWAY AGAIN FOR FIRST TIME IN 18 MONTHS
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USS MOMSEM UNDERWAY AGAIN FOR FIRST TIME IN 18 MONTHS
    3. Title: USS MOMSEN UNDERWAY AGAIN FOR FIRST TIME IN 18 MONTHS
    4. Description: PACIFIC OCEAN - FOR THE FIRST TIME SINCE DECEMBER 2013, THE GUIDED MISSILE DESTROYER USS MOMSEN (DDG 92) GOT UNDERWAY UNDER HER OWN POWER.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USS MOMSEN DEPARTS ON PACIFIC SURFACE ACTION GROUP DEPLOYMENT
    3. Title: USS MOMSEN DEPARTS ON PACIFIC SURFACE ACTION GROUP DEPLOYMENT
    4. Description: EVERETT, WASH. (NNS) -- GUIDED-MISSILE DESTROYER USS MOMSEN (DDG 92) DEPARTED HER HOMEPORT OF NAVAL STATION EVERETT FOR A SCHEDULED DEPLOYMENT TO THE WESTERN PACIFIC, APRIL 15.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USS MOMSEN DEPARTS ON PACIFIC SURFACE ACTION GROUP DEPLOYMENT
    3. Title: USS MOMSEN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USS MOMSEN HOLDS CHANGE OF COMMAND CEREMONY
    3. Title: USS MOMSEN HOLDS CHANGE OF COMMAND CEREMONY
    4. Description: EVERETT, WASH. (NNS) – SAILORS STOOD IN FORMATION ON THE FLIGHT DECK OF USS MOMSEN (DDG 92) AS PART OF A CHANGE OF COMMAND CEREMONY WHILE PIER SIDE AT NAVAL STATION EVERETT, SEP. 29TH.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USS MOMSEN HOLDS CHANGE OF COMMAND CEREMONY
    3. Title: MOMSEN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USS MOMSEN HOLDS CHANGE OF COMMAND
    3. Title: USS MOMSEN HOLDS CHANGE OF COMMAND
    4. Description: USS MOMSEN HELD A CHANGE OF COMMAND CEREMONY AT NAVAL STATION EVERETT JULY 7. THE CEREMONY MARKED THE PASSAGE OF COMMAND FROM CMDR ROBERT M. LAIRD TO CMDR WILLIAM S. BUFORD, THE SHIP'S 15TH COMMANDING OFFICER.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USS MOMSEN HOLDS CHANGE OF COMMAND
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USS MOMSEN HOSTS 14 FROM CORPS OF FOREIGN NAVAL ATTACHE
    3. Title: USS MOMSEN HOSTS 14 FROM CORPS OF FOREIGN NAVAL ATTACHé
    4. Description: NAVAL STATION EVERETT - THE CREW OF THE GUIDED-MISSILE DESTROYER USS MOMSEN (DDG 92) HOSTS 14 MEMBERS OF THE CORPS OF FOREIGN NAVAL ATTACHé, OCT. 25, FOR A FAMILIARIZATION TOUR OF THE SHIP. (U. S. NAVY PHOTO)
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USS MOMSEN HOSTS 14 FROM CORPS OF FOREIGN NAVAL ATTACHE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USS MOMSEN MAKES MID DEPLOYMENT VISIT TO SUBIC BAY
    3. Title: DDG92
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USS MOMSEN MAKES MID DEPLOYMENT VISIT TO SUBIC BAY
    3. Title: USS MOMSEN MAKES MID-DEPLOYMENT VISIT TO SUBIC BAY
    4. Description: SUBIC BAY, PHILIPPINES - THE GUIDED-MISSILE DESTROYER USS MOMSEN (DDG 92) ARRIVED IN SUBIC BAY AUG. 8 AS PART OF A U.S. 3RD FLEET PACIFIC SURFACE ACTION GROUP (PAC SAG).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USSMOMSENHOSTSPOSTDEPLOYMENTFAMILYDAYANDTIGERCRUISE
    3. Title: MOMSEN TIGERS ENJOY A STEEL BEACH PICNIC HOSTED BY THE MWR COMMITTEE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USSMOMSENHOSTSPOSTDEPLOYMENTFAMILYDAYANDTIGERCRUISE
    3. Title: USS MOMSEN HOSTS POST-DEPLOYMENT FAMILY DAY AND TIGER CRUISE
    4. Description: SEATTLE – AFTER RETURNING FROM AN INTENSE SEVEN MONTH DEPLOYMENT FROM THE SAILORS OF THE EVERETT, WASHINGTON-BASED DESTROYER USS MOMSEN (DDG 92) WERE PROUD AND EXCITED TO SHOW OFF THEIR ACCOMPLISHMENTS TO THEIR FRIENDS AND FAMILIES.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USSMOMSENARRIVESINSAIPAN
    3. Title: USS MOMSEN ARRIVES IN SAIPAN
    4. Description: SAIPAN - GUIDED-MISSILE DESTROYER USS MOMSEN (DDG 92) ARRIVED IN SAIPAN.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USSMOMSENARRIVESINSAIPAN
    3. Title: USS MOMSEN ARRIVES IN SAIPAN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USSMOMSENDEPARTSFORWESTERNPACIFICDEPLOYMENT
    3. Title: USS MOMSEN DEPARTS FOR WESTERN PACIFIC DEPLOYMENT
    4. Description: EVERETT, WASH. - THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MOMSEN (DDG 92) DEPARTED NAVAL STATION EVERETT FOR A SCHEDULED DEPLOYMENT TO THE WESTERN PACIFIC.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USSMOMSENDEPARTSFORWESTERNPACIFICDEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USSMOMSENHOLDSCHANGEOFCOMMANDCEREMONYINSEATTLE
    3. Title: USS MOMSEN HOLDS CHANGE OF COMMAND CEREMONY IN SEATTLE
    4. Description: SEATTLE – THE OFFICERS AND CREW OF USS MOMSEN (DDG 92) STOOD IN FORMATION, OVERLOOKING THE SEATTLE SKYLINE, AS CMDR. ELAINE COLLINS TURNED OVER COMMAND OF THE ARLEIGH BURKE-CLASS GUIDED MISSILE DESTROYER TO CMDR. JAVIER GONZALEZ.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USSMOMSENHOLDSCHANGEOFCOMMANDCEREMONYINSEATTLE
    3. Title: USS MOMSEN HOLDS CHANGE OF COMMAND CEREMONY IN SEATTLE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USSMOMSENPROMOTESMARITIMEDOMAINAWARENESS
    3. Title: USS MOMSEN (DDG92 ) PROMOTES MARITIME DOMAIN AWARENESS
    4. Description: MALE, MALDIVES (NOV. 18, 2010) - THE GUIDED MISSILE DESTROYER USS MOMSEN (DDG 92) ARRIVED AT MALE, MALDIVES, TO WORK WITH THE ISLAND NATION'S COAST GUARD IN IMPROVING MARITIME DOMAIN AWARENESS (MDA) WITHIN THE COUNTRY'S VAST EXCLUSIVE ECONOMIC ZONE (EEZ).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USSMOMSENPROMOTESMARITIMEDOMAINAWARENESS
    3. Title: USS MOMSEN DDG 92
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USSMOMSENRETURNSTOEVERETTAFTERFOURMONTHDEPLOYMENT
    3. Title: USS MOMSEN RETURNS TO EVERETT AFTER FOUR-MONTH DEPLOYMENT
    4. Description: EVERETT, WASH. - THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MOMSEN (DDG 92) WILL RETURN TO HER HOMEPORT OF NAVAL STATION EVERETT CONCLUDING A FOUR-MONTH DEPLOYMENT IN THE WESTERN PACIFIC.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USSMOMSENRETURNSTOEVERETTAFTERFOURMONTHDEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USSMOMSENTRAINS
    3. Title: USS MOMSEN (DDG92) TRAINS FOR SIMULTANEOUS THREATS DURING DEPLOYMENT
    4. Description: USS MOMSEN, AT SEA (NNS) -- USS MOMSEN (DDG 92) FLEXED ALL ASPECTS OF ITS PRIMARY WAR FIGHTING CAPABILITY IN A SIMULATED TACTICAL SCENARIO SEPT. 26.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USSMOMSENTRAINS
    3. Title: USS MOMSEN TRAINS FOR SIMULTANEOUS THREATS DURING DEPLOYMENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USSMOMSENUSSPREBLETURNUPDOWNUNDER
    3. Title: USS MOMSEN (DDG 92) PORT VISIT SYDNEY AUSTRALIA
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USSMOMSENUSSPREBLETURNUPDOWNUNDER
    3. Title: USS MOMSEN, USS PREBLE TURN UP DOWN UNDER
    4. Description: SYDNEY, AUSTRALIA -- ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYERS USS MOMSEN (DDG 92) AND USS PREBLE (DDG 88) ARRIVED IN SYDNEY JULY 29, FOR A PORT VISIT AFTER THEIR PARTICIPATION IN TALISMAN SABER 2013.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BECOMECITIZENONMOMSEN
    3. Title: SERVICE MEMBERS FROM THE NAVY, ARMY, AIR FORCE AND COAST GUARD BECAME AMERICAN CITIZENS ABOARD USS MOMSEN
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BECOMECITIZENONMOMSEN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO1 16MAY2016 29SEPTEMBER2017
    3. Title: (MAY 16, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO1 16MAY2016 29SEPTEMBER2017
    3. Title: CDR JASON KIPP
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO1 21AUGUST2014 16MAY2016
    3. Title: CDR JAVIER GONZALEZ
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO1 21AUGUST2014 16MAY2016
    3. Title: COMMANDING OFFICER (AUGUST 21, 2014 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO1 30SEPTEMBER 2017 4DECEMBER2018
    3. Title: (SEPTEMBER 30, 2017 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO1 30SEPTEMBER 2017 4DECEMBER2018
    3. Title: CDR ELAINE BRUNELLE
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO1 5DECEMBER2018 6JULY2020
    3. Title: (DECEMBER 5, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO1 5DECEMBER2018 6JULY2020
    3. Title: CDR ROB LAIRD
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO1 JUL10 APR11
    3. Title: CDR JAY D. WYLIE
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO1 JUL10 APR11
    3. Title: CDR JAY D. WYLIE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO1 RELIEVED 20MAY2011 14MARCH2013
    3. Title: CDR MATTHEW P. ROBERTS
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO1 RELIEVED 20MAY2011 14MARCH2013
    3. Title: CDR MATTHEW P. ROBERTS
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO1
    3. Title: CDR WILLIAM S. BUFORD
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO1
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO2 11AUGUST2017 5NOVEMBER2018
    3. Title: (AUGUST 2017 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO2 11AUGUST2017 5NOVEMBER2018
    3. Title: COMMANDER ROBERT M. LAIRD, JR
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO2 11AUG2014 11FEB2016
    3. Title: CDR JASON D. KIPP
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO2 11AUG2014 11FEB2016
    3. Title: EXECUTIVE OFFICER (AUGUST 11, 2014 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO2 12FEB2016 10AUG2017
    3. Title: COMMANDER ELAINE A. BRUNELLE
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO2 12FEB2016 10AUG2017
    3. Title: EXECUTIVE OFFICER (FEBRUARY 12, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO2 31OCTOBER2018 20MARCH2020
    3. Title: (NOVEMBER 6, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO2 31OCTOBER2018 20MARCH2020
    3. Title: CDR WILLIAM S. BUFORD
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO2 RELIEVEDNOV2011
    3. Title: LCDR PATRICK M. FUNK
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO2 RELIEVEDNOV2011
    3. Title: LCDR PATRICK M. FUNK
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO2
    3. Title: CDR ERIK S. ROBERTS
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO2
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO3 27OCTOBER2014 28NOVEMBER2016
    3. Title: (OCTOBER 27, 2014 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO3 27OCTOBER2014 28NOVEMBER2016
    3. Title: CMDCM(SW/EXW/FMF) ADAM C. LONGSDORF
    4. Description: COMMAND MASTER CHIEF
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO3 29NOVEMBER2016 27JUNE2019
    3. Title: COMMAND MASTER CHIEF
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO3 29NOVEMBER2016 27JUNE2019
    3. Title: NOVEMBER 29, 2016 - PREESENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO3
    3. Title: (JUNE 28, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: BIO3
    3. Title: COMMAND MASTER CHIEF
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: DEFAULT
    3. Title: USS MOMSEN (DDG 92)
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: HTTPWWWNAVYMILSEARCHDISPLAYASPSTORY ID=66350
    3. Title: MOMSEN SAILORS TAKE COLLEGE CLASSES WHILE UNDERWAY
    4. Description: USS MOMSEN, AT SEA - SAILORS ABOARD THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS MOMSEN (DDG 92) ARE PURSUING THEIR EDUCATION WHILE UNDERWAY THROUGH THE NAVY COLLEGE PROGRAM FOR AFLOAT COLLEGE EDUCATION (NCPACE).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: HTTPWWWNAVYMILSEARCHDISPLAYASPSTORY ID=66350
    3. Title: MOMSEN SAILORS TAKE COLLEGE CLASSES WHILE UNDERWAY
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: MOMSENSHINESINFAIR
    3. Title: MOMSEN, SHOUP SHINE IN SEAFAIR
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: MOMSENSHINESINFAIR
    3. Title: MOMSEN, SHOUP SHINE IN SEAFAIR
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: NAMESAKE
    3. Title: NAMED FOR VICE ADMIRAL CHARLES B. MOMSEN
    4. Description: IN 1929-32 HE WAS ACTIVELY ENGAGED IN THE DEVELOPMENT OF A SUBMARINE ESCAPE BREATHING APPARATUS THAT CAME TO BE KNOWN AS THE MOMSEN LUNG.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: OURSHIP
    3. Title: ABOUT THE USS MOMSEN
    4. Description: INFORMATION ABOUT THE USS MOMSEN (DDG 92).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USS MOMSEN DEPARTS DRY DOCK RETURNS TO NAVAL STATION EVERETT
    3. Title: USS MOMSEN DEPARTS DRY DOCK, RETURNS TO NAVAL STATION EVERETT
    4. Description: EVERETT, WASH. – AFTER NINE LENGTHY MONTHS AT THE VIGOR SHIPYARDS IN SEATTLE, THE GUIDED MISSILE DESTROYER USS MOMSEN (DDG 92) HAS COMPLETED SCHEDULED REPAIRS AND UPGRADES AND RETURNED TO NAVAL STATION EVERETT.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PAGES
    2. File: USS MOMSEN DEPARTS DRY DOCK RETURNS TO NAVAL STATION EVERETT
    3. Title: USS MOMSEN DEPARTS DRY DOCK, RETURNS TO NAVAL STATION EVERETT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: PHOTOS
    2. File: 110105 N 0000X 002
    3. Title: SAILORS ASSIGNED TO THE GUIDED-MISSILE DESTROYER USS MOMSEN (DDG 92) RESPOND TO A MEDICAL EMERGENCY
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PHOTOS
    2. File: 110202 N 2907P 001
    3. Title: TWO SMALL BOATS USED BY SUSPECTED PIRATES IN THE ARABIAN SEA ARE DESTROYED BY USS MOMSEN (DDG 92)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PHOTOS
    2. File: 110202 N 2907P 002
    3. Title: TWO SMALL BOATS USED BY SUSPECTED PIRATES IN THE ARABIAN SEA ARE DESTROYED BY USS MOMSEN (DDG 92)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PHOTOS
    2. File: 110202 N 2907P 003
    3. Title: TWO SMALL BOATS USED BY SUSPECTED PIRATES IN THE ARABIAN SEA ARE DESTROYED BY USS MOMSEN (DDG 92)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PHOTOS
    2. File: 120119 N OY799 229
    3. Title: USS MOMSEN (DDG 92)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PHOTOS
    2. File: 120309 N WD757 105
    3. Title: USS MOMSEN (DDG92)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PHOTOS
    2. File: MOMSEN
    3. Title: USS MOMSEN (DDG92)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PHOTOS
    2. File: TIGER LUNCH
    3. Title: MOMSEN TIGERS ENJOY A STEEL BEACH PICNIC HOSTED BY THE MWR COMMITTEE
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PHOTOS
    2. File: USS MOMSEN DDG92
    3. Title: USS MOMSEN DDG 92
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PHOTOS
    2. File: NEWCO MOMSEN
    3. Title: CMDR. JAY D. WYLIE, RIGHT, RELIEVES CMDR. ROBERT W. BODVAKE AS COMMANDING OFFICER OF USS MOMSEN
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: ATTACHEVISIT
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPEG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CDR BUFORD SMALL
    3. Title: (NOVEMBER 6, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CDR BUFORD
    3. Title: (NOVEMBER 6, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CDR WYLIE
    3. Title: CDR JAY D. WYLIE
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CDRLAIRDCO SMALL
    3. Title: (DECEMBER 5, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CDRLAIRDCO
    3. Title: (DECEMBER 5, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CMC MCFADDEN SMALL
    3. Title: CMDCM PAUL J. MCFADDEN
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CMC MCFADDEN
    3. Title: CMDCM PAUL J. MCFADDEN
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CMDCM LONGSDORF SMALL
    3. Title: (OCTOBER 27, 2014 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CMDCM LONGSDORF
    3. Title: NOVEMBER 29, 2016 - PREESENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CO COLLINS THUMBNAIL
    3. Title: CDR ELAINE A. COLLINS
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CO COLLINS
    3. Title: CDR ELAINE A. COLLINS
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CO GONZALEZ SMALL
    3. Title: COMMANDING OFFICER (AUGUST 21, 2014 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CO GONZALEZ
    3. Title: COMMANDING OFFICER (AUGUST 21, 2014 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CO ROBERTS
    3. Title: CDR MATTHEW P. ROBERTS
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: COC ARTICLE ACTUAL
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: COC ARTICLE ACTUAL
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: COC ARTICLE ACTUAL
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: DDG92 XO
    3. Title: LCDR PATRICK M. FUNK
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: MOMSEN BIG
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: MOMSEN SMALL
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: ROB LAIRD NEW SMALL
    3. Title: (AUGUST 2017 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: ROB LAIRD NEW
    3. Title: (AUGUST 2017 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: PNG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: ROBERTS BIG
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: ROBERTS SMALL
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: XO BRUNELLE SMALL
    3. Title: EXECUTIVE OFFICER (FEBRUARY 12, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: XO CDR KIPP
    3. Title: EXECUTIVE OFFICER (AUGUST 11, 2014 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: XO GONZALEZ SMALL
    3. Title: CDR JAVIER GONZALEZ
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: XO GONZALEZ
    3. Title: CDR JAVIER GONZALEZ
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: ADMIRALMOMSEN
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CMC LAMPERTH SMALL
    3. Title: NOVEMBER 29, 2016 - PREESENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CMC MEYER SMALL
    3. Title: (JUNE 28, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CMC MEYER
    3. Title: (JUNE 28, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CO CDR KIPP SMALL
    3. Title: (MAY 16, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CO CDR KIPP
    3. Title: (MAY 16, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CO CDR BRUNELLE SMALL
    3. Title: (SEPTEMBER 30, 2017 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: CO CDR BRUNELLE
    3. Title: (SEPTEMBER 30, 2017 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: COMMANDERMOMSEN
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: DDG92 MOMSEN2
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: DDG92 MOMSEN
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: LTMOMSEN
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: MOMSEN CMC
    3. Title: CMDCM MARK SWAB
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: MOMSENLUNG
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: PUBLISHINGIMAGES
    2. File: SECNAVMOMSEN
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: AN ICY REMINDER IN AN ARCTIC THAW
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: AN ICY REMINDER IN AN ARCTIC THAW
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: ANTITERRORISMEXERCISEONBOARDUSSMOMSEN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: ANTITERRORISMEXERCISEONBOARDUSSMOMSEN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO1 14MAR2013 20AUG2014
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO1 14MAR2013 20AUG2014
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO2 07NOV2011 20FEB2013
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO2 07NOV2011 20FEB2013
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO2 22FEB2013 10AUG2014
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO2 22FEB2013 10AUG2014
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO2
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO2
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO3 16NOV2012 26OCT2014
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO3 16NOV2012 26OCT2014
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO3 DEC2009 NOV2012
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO3 DEC2009 NOV2012
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: CHANGEOFCOMMANDCEREMONYONUSSMOMSEN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: CHANGEOFCOMMANDCEREMONYONUSSMOMSEN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: CHGCMD
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: CHGCMD
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: CMBTMSNTRNG
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: CMBTMSNTRNG
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: DRYDOCKPERIODCONTINUESFORUSSMOMSEN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: DRYDOCKPERIODCONTINUESFORUSSMOMSEN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: EVERETTSAILORSRECEIVEHALSLEWISLEADERSHIPEXCELLENCEAWARD
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: EVERETTSAILORSRECEIVEHALSLEWISLEADERSHIPEXCELLENCEAWARD
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: FAMILYPAGE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: FAMILYPAGE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: HOLYHELOARRIVESABOARDUSSMOMSEN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: HOLYHELOARRIVESABOARDUSSMOMSEN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: MANOVERBOARDDRILLONUSSMOMSEN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: MANOVERBOARDDRILLONUSSMOMSEN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: MOMSEN ARRIVES IN SAIPAN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: MOMSEN ARRIVES IN SAIPAN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: MOMSEN COMPLETES INSURV IN PACIFIC NW
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: MOMSEN COMPLETES INSURV IN PACIFIC NW
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: MOMSENCONDUCTSBOARDINGEXERCISE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: MOMSENCONDUCTSBOARDINGEXERCISE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: MOMSENEXPEDITIONARYMEDICALTEAMPREPAREDTOSUPPORTVBSSTEAM
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: MOMSENEXPEDITIONARYMEDICALTEAMPREPAREDTOSUPPORTVBSSTEAM
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: MOMSENSAILORSMARCHINSAIPANSLIBERATIONDAYPARADE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: MOMSENSAILORSMARCHINSAIPANSLIBERATIONDAYPARADE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: NEWS ARCHIVE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: NEWS ARCHIVE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: OMBUDSMAN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: OMBUDSMAN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: PASTLEADERSHIP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: PASTLEADERSHIP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: PHOTOS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: PHOTOS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: REPLENISHMENTATSEAONUSSMOMSEN(DDG92)
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: REPLENISHMENTATSEAONUSSMOMSEN(DDG92)
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: SAILORSABOARDUSSMOMSENRESPONDTOAMEDICALEMERGENCY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: SAILORSABOARDUSSMOMSENRESPONDTOAMEDICALEMERGENCY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: STRIKEGRPOPNS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: STRIKEGRPOPNS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USNAVYSHIPSDISRUPTPIRATEATTACK
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USNAVYSHIPSDISRUPTPIRATEATTACK
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USS MOMSEN HOLDS CHANGE OF COMMAND CEREMONY 2018
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USS MOMSEN HOLDS CHANGE OF COMMAND CEREMONY 2018
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USS MOMSEM UNDERWAY AGAIN FOR FIRST TIME IN 18 MONTHS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USS MOMSEM UNDERWAY AGAIN FOR FIRST TIME IN 18 MONTHS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USS MOMSEN DEPARTS ON PACIFIC SURFACE ACTION GROUP DEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USS MOMSEN DEPARTS ON PACIFIC SURFACE ACTION GROUP DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USS MOMSEN HOLDS CHANGE OF COMMAND CEREMONY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USS MOMSEN HOLDS CHANGE OF COMMAND CEREMONY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USS MOMSEN HOLDS CHANGE OF COMMAND
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USS MOMSEN HOLDS CHANGE OF COMMAND
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USS MOMSEN HOSTS 14 FROM CORPS OF FOREIGN NAVAL ATTACHE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USS MOMSEN HOSTS 14 FROM CORPS OF FOREIGN NAVAL ATTACHE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USS MOMSEN MAKES MID DEPLOYMENT VISIT TO SUBIC BAY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USS MOMSEN MAKES MID DEPLOYMENT VISIT TO SUBIC BAY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USSMOMSENHOSTSPOSTDEPLOYMENTFAMILYDAYANDTIGERCRUISE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USSMOMSENHOSTSPOSTDEPLOYMENTFAMILYDAYANDTIGERCRUISE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USSMOMSENARRIVESINSAIPAN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USSMOMSENARRIVESINSAIPAN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USSMOMSENDEPARTSFORWESTERNPACIFICDEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USSMOMSENDEPARTSFORWESTERNPACIFICDEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USSMOMSENHOLDSCHANGEOFCOMMANDCEREMONYINSEATTLE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USSMOMSENHOLDSCHANGEOFCOMMANDCEREMONYINSEATTLE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USSMOMSENPROMOTESMARITIMEDOMAINAWARENESS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USSMOMSENPROMOTESMARITIMEDOMAINAWARENESS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USSMOMSENRETURNSTOEVERETTAFTERFOURMONTHDEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USSMOMSENRETURNSTOEVERETTAFTERFOURMONTHDEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USSMOMSENTRAINS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USSMOMSENTRAINS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USSMOMSENUSSPREBLETURNUPDOWNUNDER
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USSMOMSENUSSPREBLETURNUPDOWNUNDER
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BECOMECITIZENONMOMSEN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BECOMECITIZENONMOMSEN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO1 16MAY2016 29SEPTEMBER2017
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO1 16MAY2016 29SEPTEMBER2017
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO1 21AUGUST2014 16MAY2016
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO1 21AUGUST2014 16MAY2016
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO1 30SEPTEMBER 2017 4DECEMBER2018
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO1 30SEPTEMBER 2017 4DECEMBER2018
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO1 5DECEMBER2018 6JULY2020
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO1 5DECEMBER2018 6JULY2020
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO1 JUL10 APR11
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO1 JUL10 APR11
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO1 RELIEVED 20MAY2011 14MARCH2013
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO1 RELIEVED 20MAY2011 14MARCH2013
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO1
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO1
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO2 11AUGUST2017 5NOVEMBER2018
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO2 11AUGUST2017 5NOVEMBER2018
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO2 11AUG2014 11FEB2016
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO2 11AUG2014 11FEB2016
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO2 12FEB2016 10AUG2017
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO2 12FEB2016 10AUG2017
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO2 31OCTOBER2018 20MARCH2020
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO2 31OCTOBER2018 20MARCH2020
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO2 RELIEVEDNOV2011
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO2 RELIEVEDNOV2011
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO2
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO2
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO3 27OCTOBER2014 28NOVEMBER2016
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO3 27OCTOBER2014 28NOVEMBER2016
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO3 29NOVEMBER2016 27JUNE2019
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO3 29NOVEMBER2016 27JUNE2019
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO3
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: BIO3
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: DEFAULT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: DEFAULT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: HTTPWWWNAVYMILSEARCHDISPLAYASPSTORY ID=66350
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: HTTPWWWNAVYMILSEARCHDISPLAYASPSTORY ID=66350
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: MOMSENSHINESINFAIR
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: MOMSENSHINESINFAIR
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: NAMESAKE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: NAMESAKE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USS MOMSEN DEPARTS DRY DOCK RETURNS TO NAVAL STATION EVERETT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92: LAYOUTS: AUTHENTICATE
    2. File: USS MOMSEN DEPARTS DRY DOCK RETURNS TO NAVAL STATION EVERETT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG92
    2. No filename (redirect)
    3. Title: USS MOMSEN (DDG 92)
    4. No description
    5. No keywords
    6. No extension (redirect)


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: DEPLOYMENT UPDATE 1 13JUN2010
    3. Title: DEPLOYMENT UPDATE #1 13 JUNE 2010
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE1 22JAN09
    3. Title: DEPLOYMENT UPDATE 1 - 22 JAN 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE1 29OCT08
    3. Title: UPDATE 1 - 29 OCT 08 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE10 15MAR09
    3. Title: DEPLOYMENT UPDATE 10 - 15 MAR 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE11 27MAR09
    3. Title: DEPLOYMENT UPDATE 11 - 27 MAR 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE12 31MAR09
    3. Title: DEPLOYMENT UPDATE 12 - 31 MAR 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE13 5APRIL09
    3. Title: DEPLOYMENT UPDATE 13 - 05 APR 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE14 14APRIL09
    3. Title: DEPLOYMENT UPDATE 14 - 14 APR 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE15 16APRIL09
    3. Title: DEPLOYMENT UPDATE 15 - 16 APR 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE16 20APRIL09
    3. Title: DEPLOYMENT UPDATE 16 - 20 APR 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE17 5MAY09
    3. Title: DEPLOYMENT UPDATE 17 - 05 MAY 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE18 16MAY09
    3. Title: DEPLOYMENT UPDATE 18 - 16 MAY 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE19 22MAY09
    3. Title: DEPLOYMENT UPDATE 19 - 22 MAY 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE2 30JAN09
    3. Title: DEPLOYMENT UPDATE 2 - 30 JAN 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE2 31OCT08
    3. Title: UPDATE 2 - 31 OCT 08 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE20 6JUNE09
    3. Title: DEPLOYMENT UPDATE 20 - 06 JUNE 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE20.5 8JUNE09
    3. Title: DEPLOYMENT UPDATE 20.5 - 08 JUNE 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE21 18JUNE09
    3. Title: DEPLOYMENT UPDATE 21 - 18 JUNE 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE22 28JUNE09
    3. Title: DEPLOYMENT UPDATE 22 - 28 JUNE 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE23 9JULY09
    3. Title: DEPLOYMENT UPDATE 23 - 28 JUNE 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE24 12JULY09
    3. Title: DEPLOYMENT UPDATE 24 - 28 JUNE 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE3 1FEB09
    3. Title: DEPLOYMENT UPDATE 3 - 01 FEB 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE3 8NOV08
    3. Title: UPDATE 3 - 08 NOV 08 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE4 11NOV08
    3. Title: UPDATE 4 - 11 NOV 08 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE4 6FEB09
    3. Title: DEPLOYMENT UPDATE 4 - 06 FEB 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE5 14NOV08
    3. Title: UPDATE 5 - 14 NOV 08 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE5 8FEB09
    3. Title: DEPLOYMENT UPDATE 5 - 08 FEB 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE6 15FEB09
    3. Title: DEPLOYMENT UPDATE 6 - 15 FEB 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE6 15NOV08
    3. Title: UPDATE 6 - 15 NOV 08 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE7 22FEB09
    3. Title: DEPLOYMENT UPDATE 7 - 22 FEB 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE8 26FEB09
    3. Title: DEPLOYMENT UPDATE 8 - 26 FEB 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: DOCUMENTS
    2. File: UPDATE9 3MAR09
    3. Title: DEPLOYMENT UPDATE 9 - 03 MAR 09 
    4. No description
    5. No keywords
    6. Extension: DOC


    1. Path: SURFOR: DDG93: MISC PHOTOS
    2. File: 100711 N 0995C SINGAPORENVYOFF
    3. Title: SINGAPORE NAVY OFFICERS OBSERVE OS2 JESSICA PROUDFOOT TRACK CONTACTS DURING AN ANTI-SUBMARINE WARFARE EXERCISE
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: MULTIMEDIA
    2. File: CHUNGHOON
    3. No title
    4. No description
    5. No keywords
    6. Extension: WMV


    1. Path: SURFOR: DDG93: PAGES
    2. File: A CORPSMAN TO CALL ON
    3. Title: A CORPSMAN TO CALL ON
    4. Description: PACIFIC OCEAN - HOSPITAL CORPSMAN 2ND CLASS ANDREW WATSON POSES FOR A PHOTO ABOARD USS CHUNG-HOON (DDG 93).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: A CORPSMAN TO CALL ON
    3. Title: A CORPSMAN TO CALL ON
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: AUSTRALIANUSSAILORSTRADEPLACESDURINGPACIFICBOND2013
    3. Title: AUSTRALIAN, U.S. SAILORS TRADE PLACES DURING PACIFIC BOND 2013
    4. Description: PACIFIC OCEAN - THE ARLEIGH-BURKE CLASS GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG-93) SWAPPED 10 CREW MEMBERS WITH ROYAL AUSTRALIAN NAVY (RAN) GUIDED-MISSILE FRIGATE HMAS SYDNEY (FFG 03), IN SUPPORT OF PACIFIC BOND 2013 TO ENHANCE OPERABILITY AND FOSTER CAMARADERIE BETWEEN THE TWO SHIPS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: AUSTRALIANUSSAILORSTRADEPLACESDURINGPACIFICBOND2013
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO1 10MAY2018 16AUGUST2019
    3. Title: CDR BRENT S. JACKSON
    4. Description: CURRENT COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO1 10MAY2018 16AUGUST2019
    3. Title: COMMANDING OFFICER (MAY 10, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO1 19JUNE2015 20OCTOBER2016
    3. Title: CDR THOMAS M. OGDEN
    4. Description: COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO1 19JUNE2015 20OCTOBER2016
    3. Title: COMMANDING OFFICER (MAY 2015 - OCTOBER 2016)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO1 21OCTOBER2016 9MAY2018
    3. Title: CDR VICTOR B. SHELDON
    4. Description: CURRENT COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO1 21OCTOBER2016 9MAY2018
    3. Title: OCTOBER 21, 2016 - PRESENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO1 30OCT2013 21MAY2015
    3. Title: CDR RYAN D. COLLINS
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO1 30OCT2013 21MAY2015
    3. Title: CDR RYAN D. COLLINS
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO1 OCT2011 29OCT2013
    3. Title: CDR JUSTIN ORLICH
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO1 OCT2011 29OCT2013
    3. Title: CDR JUSTIN ORLICH
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO1 RELIEVEDNOV2011
    3. Title: CDR STEPHEN S. ERB
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO1 RELIEVEDNOV2011
    3. Title: CDR STEPHEN S. ERB
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO1
    3. Title: (AUGUST 16, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO1
    3. Title: CDR STEPHEN J. HENZ
    4. Description: CURRENT COMMANDING OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO2 17APRIL2015 6SEPTEMBER2016
    3. Title: CDR VIC SHELDON
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO2 17APRIL2015 6SEPTEMBER2016
    3. Title: EXECUTIVE OFFICER (APRIL 17, 2015 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO2 20DECEMBER2017 25JUNE2019
    3. Title: CDR STEPHEN J. HENZ
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO2 20DECEMBER2017 25JUNE2019
    3. Title: DECEMBER 20, 2017 - PRESENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO2 30OCT2013 16APR2015
    3. Title: CDR TOM OGDEN
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO2 30OCT2013 16APR2015
    3. Title: EXECUTIVE OFFICER (OCTOBER 2013 - APRIL 2015)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO2 6SEPTEMBER2016 19DECEMBER2017
    3. Title: CDR JASON TUMLINSON
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO2 6SEPTEMBER2016 19DECEMBER2017
    3. Title: EXECUTIVE OFFICER (SEPTEMBER 6, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO2 OCT2012 OCT2013
    3. Title: CDR RYAN COLLINS
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO2 OCT2012 OCT2013
    3. Title: CDR RYAN COLLINS
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO2 RELIEVEDSEP2011
    3. Title: CDR JUSTIN ORLICH
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO2 RELIEVEDSEP2011
    3. Title: CDR JUSTIN ORLICH
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO2 RELIEVED SEPTEMBER2012
    3. Title: CDR DAVID FAUGHT
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO2 RELIEVED SEPTEMBER2012
    3. Title: CDR DAVID FRAUGHT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO2
    3. Title: (JUNE 26, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO2
    3. Title: CDR DAVID C. HOLLON
    4. Description: EXECUTIVE OFFICER
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO3 07MAR2014 04JUL2016
    3. Title: CMDCM(SW/AW) BENJAMIN D. RUSHING
    4. Description: COMMAND MASTER CHIEF
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO3 07MAR2014 04JUL2016
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO3 11MAY2018 4MAY2020
    3. Title: CMDCM(SS/SW) CHAD D. SCHULTZ
    4. Description: COMMAND MASTER CHIEF
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO3 11MAY2018 4MAY2020
    3. Title: MAY 11, 2018
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO3 5SEPTEMBER2016 20MAY2018
    3. Title: CMDCM(SW/IW) ANTHONY J. COREY
    4. Description: COMMAND MASTER CHIEF
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO3 5SEPTEMBER2016 20MAY2018
    3. Title: COMMAND MASTER CHIEF (JULY 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO3 APR2011 06MAR2014
    3. Title: CMDCM(SW) CHRIS D. DETJE
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO3 APR2011 06MAR2014
    3. Title: CMDCM(SW) CHRIS D. DETJE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO3 RELIEVEDMAY2011
    3. Title: CMDCM(SW/SS) DAVID A. UNNONE
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO3 RELIEVEDMAY2011
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO3
    3. Title: CMDCM (SW/AW) JOSEPHINE T. TAUOA
    4. Description: COMMAND MASTER CHIEF
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: BIO3
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CARAT SINGAPORE
    3. Title: AT-SEA INTEROPERABILITY IS FOCUS OF CARAT SINGAPORE
    4. Description: CHANGI, SINGAPORE (NNS) -- COOPERATION AFLOAT READINESS AND TRAINING (CARAT) SINGAPORE 2010 KICKED OFF WITH AN OPENING CEREMONY HELD AT THE FLEET AUDITORIUM AT CHANGI NAVAL BASE IN CHANGI, SINGAPORE, JULY 6
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CARAT SINGAPORE
    3. Title: AT-SEA INTEROPERABILITY IS FOCUS OF CARAT SINGAPORE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CHUNG HOON CELEBRATES MLK DAY
    3. Title: CHUNG-HOON CELEBRATES MLK DAY
    4. Description: GULF OF ADEN– SAILORS ABOARD THE GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) CELEBRATED MARTIN LUTHER KING JR. DAY, JAN. 21.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CHUNG HOON CELEBRATES MLK DAY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CHUNG HOON JAPAN KOREA CONDUCT COMBINED FORCES EXERCISE DURING RIMPAC
    3. Title: CHUNG-HOON, JAPAN, KOREA CONDUCT COMBINED FORCES EXERCISE DURING RIMPAC
    4. Description: GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93), REPUBLIC OF KOREA SEJONG THE GREAT-CLASS DESTROYER SEJONG THE GREAT (DDG 991) AND JAPAN MARITIME SELF-DEFENSE FORCE DESTROYER HELICOPTER SHIP JS HAYUGA (DDH 181) CONDUCTED A SURFACE EXERCISE JULY 16 AS PART OF THE RIM OF THE PACIFIC EXERCISE 2016.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CHUNG HOON JAPAN KOREA CONDUCT COMBINED FORCES EXERCISE DURING RIMPAC
    3. Title: DDG93
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CHUNG HOON SAILOR WINS ADMIRAL BEN MOREELL AWARD
    3. Title: CHUNG-HOON SAILOR WINS ADMIRAL BEN MOREELL AWARD
    4. Description: LOGISTICS SPECIALIST 1ST CLASS (LS1) JOSE HUERTAS WON THE 2016 ADMIRAL BEN MOREELL AWARD FOR LOGISTICS COMPETENCE.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CHUNG HOON SAILOR WINS ADMIRAL BEN MOREELL AWARD
    3. Title: USS CHUNG-HOON
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CHUNG HOON SAILORS COMBINE FORCES FOR MARITIME SECURITY OPERATIONS TRAINING
    3. Title: CHUNG-HOON SAILORS COMBINE FORCES FOR MARITIME SECURITY OPERATIONS TRAINING
    4. Description: GULF OF ADEN – U.S. NAVY SAILORS ABOARD THE GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) RECENTLY COMPLETED TRAINING FOR MARITIME SECURITY OPERATIONS IN THE GULF OF ADEN DURING THE MONTH OF DECEMBER.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CHUNG HOON SAILORS COMBINE FORCES FOR MARITIME SECURITY OPERATIONS TRAINING
    3. Title: DDG93
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CHUNG HOON WARDROOM INSPIRES NAVIGATIONAL CULTURE WITH HOKULEA SKIPPER VISIT
    3. Title: CHUNG HOON WARDROOM INSPIRES NAVIGATIONAL CULTURE WITH HOKULEA SKIPPER VISIT
    4. Description: PEARL HARBOR (NNS) -- GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) WARDROOM HOSTED BRUCE BLANKENFELD OF NIU VALLEY, HAWAII DURING A VISIT OCT. 6.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CHUNG HOON WARDROOM INSPIRES NAVIGATIONAL CULTURE WITH HOKULEA SKIPPER VISIT
    3. Title: DDG93
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CHUNG HOON WINS CRYPTOLOGIC EXCELLENCE AWARD
    3. Title: CHUNG-HOON WINS CRYPTOLOGIC EXCELLENCE AWARD
    4. Description: USS CHUNG-HOON (DDG 93) WAS AWARDED THE COMMANDER, U.S. 7TH FLEET (C7F) QUARTERLY CRYPTOLOGIC EXCELLENCE AWARD FOR CRYPTOLOGIC EFFORTS ON MAY 16.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CHUNG HOON WINS CRYPTOLOGIC EXCELLENCE AWARD
    3. Title: CHUNG-HOON WINS CRYPTOLOGIC EXCELLENCE AWARD
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CHUNG HOON TO DEPART ON WESTERN PACIFIC DEPLOYMENT
    3. Title: CHUNG-HOON TO DEPART ON WESTERN PACIFIC DEPLOYMENT
    4. Description: PEARL HARBOR - THE GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) IS SCHEDULED TO DEPART JAN. 27 ON A REGULARLY SCHEDULED STRIKE GROUP DEPLOYMENT TO THE WESTERN PACIFIC OCEAN WITH THE JOHN C. STENNIS STRIKE GROUP.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CHUNG HOON TO DEPART ON WESTERN PACIFIC DEPLOYMENT
    3. Title: USS CHUNG HOON (DDG 93)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CHUNG HOONDEPLOYSTOWESTERNPACIFIC
    3. Title: CHUNG-HOON DEPLOYS TO WESTERN PACIFIC
    4. Description: PEARL HARBOR (JUNE 1, 2011) FAMILY MEMBERS AND FRIENDS WAVE GOODBYE TO SAILORS MANNING THE RAILS OF GUIDED-MISSILE DESTROYER USS CHUNG HOON (DDG 93) AS IT DEPARTS FROM JOINT BASE PEARL HARBOR-HICKAM.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CHUNG HOONDEPLOYSTOWESTERNPACIFIC
    3. Title: USS CHUNG-HOON DDG 93 DEPLOYS
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CHUNG HOONXO,ALONGWITH
    3. Title: CHUNG_HOON XO, ALONG WITH NAVY COMMAND LEADERSHIP STUDENTS STUDY TRAINING METHODS
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CHUNG HOONXO,ALONGWITH
    3. Title: CHUNG_HOON XO, ALONG WITH NAVY COMMAND LEADERSHIP STUDENTS STUDY TRAINING METHODS
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CHUNG OONSAILORSPARTICIPATEINFUNRUNATALVAHASCOTTELEMENTARY
    3. Title: CHUNG-HOON SAILORS PARTICIPATE IN "FUN RUN"AT ALVAH A. SCOTT ELEMENTARY
    4. Description: AEIA, HAWAII —IT WAS ALOHA FRIDAY FOR THE STUDENTS OF ALVAH A. SCOTT ELEMENTARY SCHOOL WHEN THEIR ANNUAL FUN RUN FIELD DAY.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: CHUNG OONSAILORSPARTICIPATEINFUNRUNATALVAHASCOTTELEMENTARY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: DDG93 EYEONFLEET
    3. Title: FIRE FIGHTING
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: DDG93 EYEONFLEET
    3. Title: SURFACE LINE WEEK DAMAGE CONTROL OLYMPICS
    4. Description: SAILORS ASSIGNED TO THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) CYCLE THROUGH THE DIFFERENT HOSE SETTINGS DURING A SURFACE LINE WEEK DAMAGE CONTROL OLYMPICS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: DDG93AVAIL
    3. Title: NAVSEA SHIPYARD COMPLETES USS CHUNG-HOON AVAILABILITY EARLY
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: DDG93AVAIL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: EXPANDEDAT SEATRAININGHIGHLIGHTSUSSINGAPORECARATEXERCISE
    3. Title: EXPANDED AT-SEA TRAINING HIGHLIGHTS U.S., SINGAPORE CARAT EXERCISE
    4. Description: SINGAPORE - THE ARRIVAL OF TWO U.S. NAVY DESTROYERS TO SINGAPORE, FOLLOWED BY AN OPENING CEREMONY AT CHANGI NAVAL BASE AUG. 15 MARKS THE BEGINNING OF THE 17TH COOPERATION AFLOAT READINESS AND TRAINING (CARAT) SINGAPORE EXERCISE.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: EXPANDEDAT SEATRAININGHIGHLIGHTSUSSINGAPORECARATEXERCISE
    3. Title: USS CHUNG HOON (DDG 93)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: FAMILYDAYCRUISE
    3. Title: USS CHUNG-HOON HOSTS A FAMILY DAY CRUISE
    4. Description: PEARL HARBOR (NNS) -- THE GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) HELD A CRUISE FOR FAMILY MEMBERS, 70 HONOLULU NAVY LEAGUE MEMBERS AND SEVEN LOCAL BLOGGERS APRIL 5
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: FAMILYDAYCRUISE
    3. Title: USS CHUNG-HOON HOSTS A FAMILY DAY CRUISE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: FAMILYREUNIONATSEA
    3. Title: CDR. JUSTIN ORLICH, CO OF USS CHUNG-HOON VISITS WITH HIS NEICE LT. J.G. LAUREL FERNANDES WHO IS ASSIGNED TO USS BLUE RIDGE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: FAMILYREUNIONATSEA
    3. Title: FAMILY REUNION AT SEA
    4. Description: SOUTH CHINA SEA - CDR. JUSTIN ORLICH, COMMANDING OFFICER OF THE ARLEIGH BURKE-CLASS AEGIS DESTROYER USS CHUNG-HOON (DDG 93) VISITS WITH HIS NEICE LT. J.G. LAUREL FERNANDES WHO IS ASSIGNED TO THE U.S. 7TH FLEET FLAGSHIP USS BLUE RIDGE (LCC 19).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: FAMILY
    3. Title: FAMILY - USS CHUNG-HOON
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: FORGED AND READY CHUNG HOON LEGACY
    3. Title: FORGED AND READY CHUNG-HOON LEGACY
    4. Description: THIS BLOG ORIGINALLY APPEARED ON NAVY LIVE. HTTP://NAVYLIVE.DODLIVE.MIL/2018/07/25/FORGED-AND-READY-CHUNG-HOON-LEGACY/"
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: FORGED AND READY CHUNG HOON LEGACY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: FRMRSKIPPER2RCV STOCKDALEAWD
    3. Title: FORMER CHUNG-HOON SKIPPER TO RECEIVE STOCKDALE AWARD
    4. Description: WASHINGTON (NNS) -- THE FORMER COMMANDING OFFICER (CO) OF USS CHUNG-HOON (DDG 93) AND THE CURRENT CO OF THE USS MARYLAND (SSBN 738) (GOLD CREW) WERE ANNOUNCED AS WINNERS OF THE 2010 VICE ADM. JAMES BOND STOCKDALE LEADERSHIP AWARD FOR THE U.S. PACIFIC FLEET AND U.S. FLEET FORCES COMMAND, RESPECTIVELY, SEPT. 13
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: FRMRSKIPPER2RCV STOCKDALEAWD
    3. Title: FORMER CHUNG-HOON SKIPPER TO RECEIVE STOCKDALE AWARD
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: NEWS ARCHIVE
    3. Title: NEWS ARCHIVE
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: OMBUDSMAN
    3. Title: OMBUDSMAN - USS CHUNG-HOON
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: OURSHIP
    3. No title
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: PASTLEADERSHIP
    3. Title: PAST LEADERSHIP
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: SINGAPORENAVYOFFICERSOBSERVEASW
    3. Title: SINGAPORE NAVY OFFICERS OBSERVE ANTI-SUBMARINE WARFARE EXERCISE
    4. Description: SOUTH CHINA SEA (JULY 11, 2010) REPUBLIC OF SINGAPORE NAVY OFFICERS OBSERVE OPERATIONS SPECIALIST 2ND CLASS JESSICA PROUDFOOT TRACK CONTACTS DURING AN ANTI-SUBMARINE WARFARE EXERCISE ABOARD THE GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) FOR COOPERATION AFLOAT READINESS AND TRAINING (CARAT) SINGAPORE 2010. CARAT IS A SERIES OF BILATERAL EXERCISES HELD ANNUALLY IN SOUTHEAST ASIA TO STRENGTHEN RELATIONSHIPS AND ENHANCE FORCE READINESS.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: SINGAPORENAVYOFFICERSOBSERVEASW
    3. Title: SINGAPORE NAVY OFFICERS OBSERVE OS2 JESSICA PROUDFOOT TRACK CONTACTS DURING AN ANTI-SUBMARINE WARFARE EXERCISE
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: THE WAY OF THE FUTURE 3 D PRINTING
    3. Title: THE WAY OF THE FUTURE 3-D PRINTING
    4. Description: ON AUGUST 24, 2018, THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) FACED A PROBLEM THAT DIDN’T HAVE A QUICK SOLUTION.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: THE WAY OF THE FUTURE 3 D PRINTING
    3. Title: DDG93
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: TSUNAMIEVAC
    3. Title: USS CHUNG-HOON (DDG 93) MAKES ITS WAY OUT OF NAVAL STATION PEARL HARBOR AS THE STATE OF HAWAII IS EXPECTING A TSUNAMI GENERATED BY AN EARTHQUAKE NEAR CHILE.
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: TSUNAMIEVAC
    3. Title: USS CHUNG-HOON (DDG 93) MAKES ITS WAY OUT OF NAVAL STATION PEARL HARBOR AS THE STATE OF HAWAII IS EXPECTING A TSUNAMI
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USNAVYBEGINSANNUALVIETNAMNAVALENGAGEMENTACTIVITY
    3. Title: U.S. NAVY BEGINS ANNUAL VIETNAM NAVAL ENGAGEMENT ACTIVITY
    4. Description: DA NANG, VIETNAM - THE GUIDED-MISSILE DESTROYER USS CHUNG HOON (DDG 93) ARRIVES IN DA NANG, VIETNAM, FOR A NAVAL ENGAGEMENT ACTIVITY.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USNAVYBEGINSANNUALVIETNAMNAVALENGAGEMENTACTIVITY
    3. Title: USS CHUNG HOON (DDG 93)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USS CHUNG HOON HOLDS 10TH CHANGE OF COMMAND
    3. Title: PEARL HARBOR (NNS) -- USS CHUNG-HOON (DDG 93) HELD A CHANGE OF COMMAND CEREMONY AT JOINT BASE PEARL HARBOR-HICKAM, AUGUST 16.
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USS CHUNG HOON HOLDS 10TH CHANGE OF COMMAND
    3. Title: USS CHUNG-HOON HOLDS 10TH CHANGE OF COMMAND
    4. Description: PEARL HARBOR (NNS) -- USS CHUNG-HOON (DDG 93) HELD A CHANGE OF COMMAND CEREMONY AT JOINT BASE PEARL HARBOR-HICKAM, AUGUST 16.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USS CHUNG HOON RECEIVES 2016 SECNAV SAFETY EXCELLENCE AWARD
    3. Title: USS CHUNG-HOON RECEIVES 2016 SECNAV SAFETY EXCELLENCE AWARD
    4. Description: WASHINGTON (NNS) -- USS CHUNG-HOON WAS RECENTLY AWARDED THE FISCAL YEAR 2016 SECRETARY OF THE NAVY (SECNAV) SAFETY EXCELLENCE AWARD FOR THE AFLOAT UNIT CATEGORY.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USS CHUNG HOON RECEIVES 2016 SECNAV SAFETY EXCELLENCE AWARD
    3. Title: CHUNG HOON
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USS CHUNG HOON RECEIVES NEW COMMANDER
    3. Title: USS CHUNG-HOON RECEIVES NEW COMMANDER
    4. Description: SAN DIEGO (NNS) -- THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) HELD A CHANGE OF COMMAND CEREMONY MAY 9 WHILE UNDERWAY OFF THE COAST OF SOUTHERN CALIFORNIA AS PART OF GROUP SAIL WITH CARRIER STRIKE GROUP (CSG) 3.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USS CHUNG HOON RECEIVES NEW COMMANDER
    3. Title: USS CHUNG-HOON RECEIVES NEW COMMANDER
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USS CHUNG HOON SAILORS REMEMBER USS SIGSBEE
    3. Title: USS CHUNG-HOON SAILORS REMEMBER USS SIGSBEE
    4. Description: SOUTH CHINA SEA (NNS) -- SAILORS ABOARD GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) OPERATING IN THE SOUTH CHINA SEA REMEMBER USS SIGSBEE (DD 502).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USS CHUNG HOON SAILORS REMEMBER USS SIGSBEE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USS CHUNG HOON DEPARTS FOR WESTERN PACIFIC DEPLOYMENT
    3. Title: USS CHUNG-HOON DEPARTS FOR WESTERN PACIFIC DEPLOYMENT
    4. Description: THE GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) DEPARTED JOINT BASE PEARL HARBOR-HICKAM JAN. 27 ON A REGULARLY SCHEDULED STRIKE GROUP DEPLOYMENT TO THE WESTERN PACIFIC OCEAN WITH THE JOHN C. STENNIS STRIKE GROUP.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USS CHUNG HOON DEPARTS FOR WESTERN PACIFIC DEPLOYMENT
    3. Title: USS CHUNG-HOON
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USS CHUNG HOON TO RETURN FROM DEPLOYMENT
    3. Title: USS CHUNG-HOON TO RETURN FROM DEPLOYMENT
    4. Description: JOINT BASE PEARL HARBOR-HICKAM, HAWAII - THE GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) IS SCHEDULED TO RETURN FROM A FIVE-MONTH DEPLOYMENT TO THE WESTERN PACIFIC (WESTPAC).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USS CHUNG HOON TO RETURN FROM DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNG HOONDDG93DEPLOYSTOWESTERNPACIFIC
    3. Title: USS CHUNG-HOON (DDG 93) DEPLOYS TO WESTERN PACIFIC
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNG HOONDDG93DEPLOYSTOWESTERNPACIFIC
    3. Title: USS CHUNG-HOON (DDG 93) DEPLOYS TO WESTERN PACIFIC
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNG HOONHONORSSIGSBEESAILORS
    3. Title: USS CHUNG-HOON HONORS SIGSBEE SAILORS
    4. Description: PEARL HARBOR (APR. 15, 2011) - THE CREW OF THE GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) AND MEMBERS OF THE NAVY LEAGUE HONOLULU COUNCIL (NLHC) HONORED SAILORS OF THE DESTROYER USS SIGSBEE IN A CEREMONY ABOARD CHUNG-HOON'S FLIGHT DECK, APRIL 14.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNG HOONHONORSSIGSBEESAILORS
    3. Title: USS CHUNG-HOON HONORS SIGSBEE SAILORS
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNG HOONRETURNSHOME
    3. Title: USS CHUNG-HOON RETURNS HOME
    4. Description: PEARL HARBOR - THE ARLEIGH-BURKE CLASS GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG-93) RETURNED HOME TO JOINT BASE PEARL HARBOR-HICKAM (JBPHH) FROM A SIX-MONTH INDEPENDENT DEPLOYMENT DEC. 1.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNG HOONRETURNSHOME
    3. Title: USS CHUNG-HOON RETURNS HOME
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNG HOONRETURNSFROMDEPLOYMENT
    3. Title: USS CHUNG-HOON RETURNS FROM DEPLOYMENT
    4. Description: PEARL HARBOR-HICKAM, HAWAII – GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) RETURNS FROM A SIX-MONTH INDEPENDENT DEPLOYMENT TO THE WESTERN PACIFIC.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNG HOONRETURNSFROMDEPLOYMENT
    3. Title: USS CHUNG-HOON RETURNS FROM DEPLOYMENT
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNG HOONTODEPLOYTOWESTERNPACIFIC
    3. Title: USS CHUNG-HOON TO DEPLOY TO WESTERN PACIFIC
    4. Description: PEARL HARBOR, HAWAII - THE GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) WILL DEPART JOINT BASE PEARL HARBOR-HICKAM APRIL 2 FOR AN INDEPENDENT DEPLOYMENT TO THE INDO-ASIA-PACIFIC REGION.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNG HOONTODEPLOYTOWESTERNPACIFIC
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNGHOONDEPARTSHAWAIIONDEPLOYMENT
    3. Title: USS CHUNG-HOON DEPARTS HAWAII ON DEPLOYMENT
    4. Description: PEARL HARBOR - THE GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) DEPARTED JOINT BASE PEARL HARBOR-HICKAM APRIL 2 ON AN INDEPENDENT DEPLOYMENT TO THE INDO-ASIA-PACIFIC REGION
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNGHOONDEPARTSHAWAIIONDEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNGHOONENTERS7THFLEET
    3. Title: USS CHUNG-HOON ENTERS 7TH FLEET
    4. Description: PACIFIC OCEAN - THE ARLEIGH-BURKE CLASS GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) ARRIVED IN THE U.S. 7TH FLEET AREA OF OPERATIONS APRIL 6 AFTER DEPARTING JOINT BASE PEARL HARBOR-HICKAM APRIL 2 FOR AN INDEPENDENT DEPLOYMENT TO THE INDO-ASIA-PACIFIC REGION.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNGHOONENTERS7THFLEET
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNGHOONREMEMBERSBATTLEOFMIDWAY
    3. Title: USS CHUNG-HOON REMEMBERS BATTLE OF MIDWAY
    4. Description: SOUTH CHINA SEA - THE ARLEIGH BURKE-CLASS GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) HONORED THE MEMORY OF FALLEN SERVICE-MEMBERS FROM THE BATTLE OF MIDWAY WITH A CEREMONY.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNGHOONREMEMBERSBATTLEOFMIDWAY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNGHOONREMEMBERSUSSSIGSBEE
    3. Title: USS CHUNG-HOON (DDG93)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNGHOONREMEMBERSUSSSIGSBEE
    3. Title: USS CHUNG-HOON REMEMBERS USS SIGSBEE
    4. Description: PEARL HARBOR, HAWAII - THE CREW OF GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) HONORED SAILORS OF THE FLETCHER-CLASS DESTROYER USS SIGSBEE (DD 502), APRIL 16.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNGHOONRETURNSHOMETOPEARLHARBOR
    3. Title: USS CHUNG-HOON RETURNS HOME TO PEARL HARBOR
    4. Description: PEARL HARBOR - THE GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) RETURNED TO THE SHIP'S HOMEPORT OF JOINT BASE PEARL HARBOR-HICKAM OCT. 1 FOLLOWING A SIX-MONTH DEPLOYMENT TO THE WESTERN PACIFIC.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNGHOONRETURNSHOMETOPEARLHARBOR
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNGHOONDISPLAYSHOLIDAYLIGHTS
    3. Title: USS CHUNG-HOON DISPLAYS HOLIDAY LIGHTS
    4. Description: PEARL HARBOR - HOLIDAY LIGHTS WITH THE HAWAIIAN PHRASE "MELE KALIKIMAKA"(MERRY CHRISTMAS) ARE DISPLAYED ABOARD THE ARLEIGH BURKE-CLASS AEGIS DESTROYER USS CHUNG-HOON (DDG 93).
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSCHUNGHOONDISPLAYSHOLIDAYLIGHTS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSINGAPOREANNAVIES
    3. Title: U.S. AND SINGAPOREAN NAVIES COMPLETE CARAT SINGAPORE 2011
    4. Description: SOUTH CHINA SEA - U.S. AND SINGAPOREAN SAILORS COMPLETED THE AT-SEA PORTION OF THE 17TH ANNUAL COOPERATION AFLOAT READINESS AND TRAINING (CARAT) SINGAPORE 2011 AUG. 26 FOLLOWING SIX DAYS OF UNDERWAY TRAINING.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USSINGAPOREANNAVIES
    3. Title: USS CHUNG HOON
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: WELCOME
    3. Title: WELCOME ABOARD
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: DEFAULT
    3. Title: USS CHUNG HOON (DDG 93)
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: DEFAULT
    3. Title: USS CHUNG-HOON (DDG 93)
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: HISTORY
    3. Title: NAMED IN HONOR OF REAR ADMIRAL GORDOR PAI'EA CHUNG-HOON
    4. Description: REAR ADMIRAL CHUNG-HOON IS A RECIPIENT OF THE NAVY CROSS AND SILVER STAR FOR CONSPICUOUS GALLANTRY AND EXTRAORDINARY HEROISM AS COMMANDING OFFICER OF USS SIGSBEE (DD 502) FROM MAY 1944 TO OCTOBER 1945.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: LINKS
    3. Title:
  • LINKS

  • 4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: OURSHIP
    3. Title: ABOUT US
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: PHOTOS
    3. Title: PHOTOS
    4. No description
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USS CHUNG HOON HOSTS PEARL HARBOR DAY COMMEMORATION CEREMONY
    3. Title: USS CHUNG-HOON HOSTS PEARL HARBOR DAY COMMEMORATION CEREMONY
    4. Description: PEARL HARBOR (DEC. 7, 2014) THE GUIDED-MISSILE DESTROYER USS CHUNG-HOON (DDG 93) CONDUCTS A PASS-IN-REVIEW BY THE USS ARIZONA MEMORIAL DURING THE 73RD ANNIVERSARY PEARL HARBOR DAY COMMEMORATION CEREMONY AT THE PEARL HARBOR VISITOR CENTER.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USS CHUNG HOON HOSTS PEARL HARBOR DAY COMMEMORATION CEREMONY
    3. Title: USS CHUNG-HOON HOSTS PEARL HARBOR DAY COMMEMORATION CEREMONY
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USS CHUNG HOON TO VISIT HILO FOR MERRIE MONARCH FESTIVAL
    3. Title: USS CHUNG-HOON TO VISIT HILO FOR MERRIE MONARCH FESTIVAL
    4. Description: PEARL HARBOR -THE PEARL HARBOR-BASED AEGIS-CLASS GUIDED MISSILE DESTROYER USS CHUNG-HOON (DDG-93) WILL VISIT HILO TO PARTICIPATE IN THE 52ND ANNUAL MERRIE MONARCH FESTIVAL.
    5. Keywords: NAVY, USN, US NAVY, SAILOR, PACIFIC
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PAGES
    2. File: USS CHUNG HOON TO VISIT HILO FOR MERRIE MONARCH FESTIVAL
    3. Title: USS CHUNG-HOON TO VISIT HILO FOR MERRIE MONARCH FESTIVAL
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: 012916 01
    3. Title: USS CHUNG-HOON
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: ADM CHUNGHOON PORTRAIT
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CDR COLLINS (COVERED)
    3. Title: CDR RYAN COLLINS
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CDR HOLLON SMALL
    3. Title: (JUNE 26, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CDR HOLLON
    3. Title: (JUNE 26, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CDR ORLICH PHOTO
    3. Title: CDR JUSTIN ORLICH
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CDR SHELDON NEW
    3. Title: OCTOBER 21, 2016 - PRESENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CDR SHELDON SMALL NEW
    3. Title: OCTOBER 21, 2016 - PRESENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CMC AJ COREY SMALL
    3. Title: COMMAND MASTER CHIEF (JULY 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CMC AJ COREY
    3. Title: COMMAND MASTER CHIEF (JULY 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CMC DETJE
    3. Title: CMDCM(SW) CHRIS D. DETJE
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CO CDR JACKSON SMALL
    3. Title: COMMANDING OFFICER (MAY 10, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CO CDR JACKSON
    3. Title: COMMANDING OFFICER (MAY 10, 2018 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CO COLLINS SMALL
    3. Title: CDR RYAN D. COLLINS
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CO COLLINS
    3. Title: CDR RYAN D. COLLINS
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CO OGDEN SMALL
    3. Title: COMMANDING OFFICER (MAY 2015 - OCTOBER 2016)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CO OGDEN
    3. Title: COMMANDING OFFICER (MAY 2015 - OCTOBER 2016)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CHGHN CO CDR ERB
    3. Title: CDR STEPHEN S. ERB
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: DDG93 AVAIL
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: DDG93 EOF 1109
    3. Title: FIRE FIGHTING
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: TAUOA BIG
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: TAUOA SMALL
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: XO FAUGHT
    3. Title: CDR DAVID FRAUGHT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: XO OGDEN SMALL
    3. Title: EXECUTIVE OFFICER (OCTOBER 2013 - APRIL 2015)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: XO OGDEN
    3. Title: EXECUTIVE OFFICER (OCTOBER 2013 - APRIL 2015)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: XO SHELDON SMALL
    3. Title: EXECUTIVE OFFICER (APRIL 17, 2015 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: XO SHELDON
    3. Title: EXECUTIVE OFFICER (APRIL 17, 2015 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: XO
    3. Title: CDR JUSTIN ORLICH
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CDR HENZ SMALL
    3. Title: (AUGUST 16, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CDR HENZ
    3. Title: (AUGUST 16, 2019 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CDR JASON TUMLINSON SMALL
    3. Title: EXECUTIVE OFFICER (SEPTEMBER 6, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CDR JASON TUMLINSON
    3. Title: EXECUTIVE OFFICER (SEPTEMBER 6, 2016 - PRESENT)
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CMC SCHULTZ SMALL
    3. Title: MAY 11, 2018
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: CMC SCHULTZ
    3. Title: MAY 11, 2018
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: DDG93 CMC
    3. No title
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: DDG93 CO
    3. Title: FORMER USS CHUNG_HOON SKIPPER, COMMANDER MCCARTNEY
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: DDG93ART
    3. Title: USS CHUNG-HOON (DDG 93) - CLICK TO SEE LARGER IMAGE
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: DESRON31
    3. Title: DESRON 31
    4. No description
    5. No keywords
    6. Extension: GIF


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: HELMET
    3. Title: HELMET
    4. No description
    5. No keywords
    6. Extension: GIF


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: SPLASH
    3. Title: DDG 93
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: XO CDR HENZ SMALL
    3. Title: DECEMBER 20, 2017 - PRESENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: PUBLISHINGIMAGES
    2. File: XO CDR HENZ
    3. Title: DECEMBER 20, 2017 - PRESENT
    4. No description
    5. No keywords
    6. Extension: JPG


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: A CORPSMAN TO CALL ON
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: A CORPSMAN TO CALL ON
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: AUSTRALIANUSSAILORSTRADEPLACESDURINGPACIFICBOND2013
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: AUSTRALIANUSSAILORSTRADEPLACESDURINGPACIFICBOND2013
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO1 10MAY2018 16AUGUST2019
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO1 10MAY2018 16AUGUST2019
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO1 19JUNE2015 20OCTOBER2016
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO1 19JUNE2015 20OCTOBER2016
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO1 21OCTOBER2016 9MAY2018
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO1 21OCTOBER2016 9MAY2018
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO1 30OCT2013 21MAY2015
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO1 30OCT2013 21MAY2015
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO1 OCT2011 29OCT2013
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO1 OCT2011 29OCT2013
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO1 RELIEVEDNOV2011
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO1 RELIEVEDNOV2011
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO1
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO1
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO2 17APRIL2015 6SEPTEMBER2016
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO2 17APRIL2015 6SEPTEMBER2016
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO2 20DECEMBER2017 25JUNE2019
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO2 20DECEMBER2017 25JUNE2019
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO2 30OCT2013 16APR2015
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO2 30OCT2013 16APR2015
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO2 6SEPTEMBER2016 19DECEMBER2017
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO2 6SEPTEMBER2016 19DECEMBER2017
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO2 OCT2012 OCT2013
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO2 OCT2012 OCT2013
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO2 RELIEVEDSEP2011
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO2 RELIEVEDSEP2011
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO2 RELIEVED SEPTEMBER2012
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO2 RELIEVED SEPTEMBER2012
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO2
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO2
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO3 07MAR2014 04JUL2016
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO3 07MAR2014 04JUL2016
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO3 11MAY2018 4MAY2020
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO3 11MAY2018 4MAY2020
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO3 5SEPTEMBER2016 20MAY2018
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO3 5SEPTEMBER2016 20MAY2018
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO3 APR2011 06MAR2014
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO3 APR2011 06MAR2014
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO3 RELIEVEDMAY2011
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO3 RELIEVEDMAY2011
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO3
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: BIO3
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CARAT SINGAPORE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CARAT SINGAPORE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CHUNG HOON CELEBRATES MLK DAY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CHUNG HOON CELEBRATES MLK DAY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CHUNG HOON JAPAN KOREA CONDUCT COMBINED FORCES EXERCISE DURING RIMPAC
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CHUNG HOON JAPAN KOREA CONDUCT COMBINED FORCES EXERCISE DURING RIMPAC
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CHUNG HOON SAILOR WINS ADMIRAL BEN MOREELL AWARD
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CHUNG HOON SAILOR WINS ADMIRAL BEN MOREELL AWARD
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CHUNG HOON SAILORS COMBINE FORCES FOR MARITIME SECURITY OPERATIONS TRAINING
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CHUNG HOON SAILORS COMBINE FORCES FOR MARITIME SECURITY OPERATIONS TRAINING
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CHUNG HOON WARDROOM INSPIRES NAVIGATIONAL CULTURE WITH HOKULEA SKIPPER VISIT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CHUNG HOON WARDROOM INSPIRES NAVIGATIONAL CULTURE WITH HOKULEA SKIPPER VISIT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CHUNG HOON WINS CRYPTOLOGIC EXCELLENCE AWARD
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CHUNG HOON WINS CRYPTOLOGIC EXCELLENCE AWARD
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CHUNG HOON TO DEPART ON WESTERN PACIFIC DEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CHUNG HOON TO DEPART ON WESTERN PACIFIC DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CHUNG HOONDEPLOYSTOWESTERNPACIFIC
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CHUNG HOONDEPLOYSTOWESTERNPACIFIC
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CHUNG HOONXO,ALONGWITH
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CHUNG HOONXO,ALONGWITH
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CHUNG OONSAILORSPARTICIPATEINFUNRUNATALVAHASCOTTELEMENTARY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: CHUNG OONSAILORSPARTICIPATEINFUNRUNATALVAHASCOTTELEMENTARY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: DDG93 EYEONFLEET
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: DDG93 EYEONFLEET
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: DDG93AVAIL
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: DDG93AVAIL
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: EXPANDEDAT SEATRAININGHIGHLIGHTSUSSINGAPORECARATEXERCISE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: EXPANDEDAT SEATRAININGHIGHLIGHTSUSSINGAPORECARATEXERCISE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: FAMILYDAYCRUISE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: FAMILYDAYCRUISE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: FAMILYREUNIONATSEA
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: FAMILYREUNIONATSEA
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: FAMILY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: FAMILY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: FORGED AND READY CHUNG HOON LEGACY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: FORGED AND READY CHUNG HOON LEGACY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: FRMRSKIPPER2RCV STOCKDALEAWD
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: FRMRSKIPPER2RCV STOCKDALEAWD
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: NEWS ARCHIVE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: NEWS ARCHIVE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: OMBUDSMAN
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: OMBUDSMAN
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: PASTLEADERSHIP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: PASTLEADERSHIP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: SINGAPORENAVYOFFICERSOBSERVEASW
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: SINGAPORENAVYOFFICERSOBSERVEASW
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: THE WAY OF THE FUTURE 3 D PRINTING
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: THE WAY OF THE FUTURE 3 D PRINTING
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: TSUNAMIEVAC
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: TSUNAMIEVAC
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USNAVYBEGINSANNUALVIETNAMNAVALENGAGEMENTACTIVITY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USNAVYBEGINSANNUALVIETNAMNAVALENGAGEMENTACTIVITY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USS CHUNG HOON HOLDS 10TH CHANGE OF COMMAND
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USS CHUNG HOON HOLDS 10TH CHANGE OF COMMAND
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USS CHUNG HOON RECEIVES 2016 SECNAV SAFETY EXCELLENCE AWARD
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USS CHUNG HOON RECEIVES 2016 SECNAV SAFETY EXCELLENCE AWARD
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USS CHUNG HOON RECEIVES NEW COMMANDER
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USS CHUNG HOON RECEIVES NEW COMMANDER
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USS CHUNG HOON SAILORS REMEMBER USS SIGSBEE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USS CHUNG HOON SAILORS REMEMBER USS SIGSBEE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USS CHUNG HOON DEPARTS FOR WESTERN PACIFIC DEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USS CHUNG HOON DEPARTS FOR WESTERN PACIFIC DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USS CHUNG HOON TO RETURN FROM DEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USS CHUNG HOON TO RETURN FROM DEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNG HOONDDG93DEPLOYSTOWESTERNPACIFIC
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNG HOONDDG93DEPLOYSTOWESTERNPACIFIC
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNG HOONHONORSSIGSBEESAILORS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNG HOONHONORSSIGSBEESAILORS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNG HOONRETURNSHOME
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNG HOONRETURNSHOME
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNG HOONRETURNSFROMDEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNG HOONRETURNSFROMDEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNG HOONTODEPLOYTOWESTERNPACIFIC
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNG HOONTODEPLOYTOWESTERNPACIFIC
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNGHOONDEPARTSHAWAIIONDEPLOYMENT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNGHOONDEPARTSHAWAIIONDEPLOYMENT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNGHOONENTERS7THFLEET
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNGHOONENTERS7THFLEET
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNGHOONREMEMBERSBATTLEOFMIDWAY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNGHOONREMEMBERSBATTLEOFMIDWAY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNGHOONREMEMBERSUSSSIGSBEE
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNGHOONREMEMBERSUSSSIGSBEE
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNGHOONRETURNSHOMETOPEARLHARBOR
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNGHOONRETURNSHOMETOPEARLHARBOR
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNGHOONDISPLAYSHOLIDAYLIGHTS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSCHUNGHOONDISPLAYSHOLIDAYLIGHTS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSINGAPOREANNAVIES
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: USSINGAPOREANNAVIES
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: WELCOME
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: WELCOME
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: DEFAULT
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: DEFAULT
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: HISTORY
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: HISTORY
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: NEWSLETTERS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: NEWSLETTERS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: OURSHIP
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: PHOTOS
    3. Title: SIGN IN
    4. No description
    5. No keywords
    6. Extension: ASPX


    1. Path: SURFOR: DDG93: LAYOUTS: AUTHENTICATE
    2. File: PHOTOS
    3. No title
    4. No description
    5. No keywords
    6. Extension: ASPX